Overview

  • Product name

    Anti-Proteasome Activator Subunit 4/PSME4 antibody
    See all Proteasome Activator Subunit 4/PSME4 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome Activator Subunit 4/PSME4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome Activator Subunit 4/PSME4 aa 1-50.
    Sequence:

    MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDL


    Database link: NP_055429.2

  • Positive control

    • 293T, HeLa and Jurkat whole cell lysates.
  • General notes

     This product was previously labelled as Proteasome Activator Subunit 4

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab157158 was affinity purified using an epitope specific to Proteasome Activator Subunit 4/PSME4 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab157158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000.
WB 1/1000 - 1/5000. Predicted molecular weight: 211 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Activates proteasomal cleavage of peptides in an energy-independent manner. May be involved in spermatogenesis. May be involved in DNA repair.
  • Sequence similarities

    Contains 6 HEAT repeats.
  • Cellular localization

    Nucleus. Nucleus speckle. Found in nuclear foci following treatment with ionizing radiation, but not with ultraviolet irradiation or H(2).
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0077 antibody
    • PA200 antibody
    • Proteasome Activator 200 kDa antibody
    • Proteasome activator complex subunit 4 antibody
    • Proteasome activator PA200 antibody
    • PSME 4 antibody
    • psme4 antibody
    • PSME4_HUMAN antibody
    see all

Images

  • All lanes : Anti-Proteasome Activator Subunit 4/PSME4 antibody (ab157158) at 0.4 µg/ml

    Lane 1 : 293T whole
    cell lysate at 50 µg
    Lane 2 : 293T whole
    cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole
    cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 211 kDa


    Exposure time: 3 minutes
  • Detection of Proteasome Activator Subunit 4/PSME4 by Western Blot of Immunprecipitate.
    ab157158 at 1µg/ml labeling Proteasome Activator Subunit 4/PSME4 in 293T whole cell lysate immunoprecipitated using ab157158 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).
    Detection: Chemiluminescence with exposure time of 10 seconds.

  • Immunohistochemistry if human non-small cell lung cancer staining Proteasome Activator Subunit 4/PSME4 with ab157158 at 1/1000. 

References

ab157158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up