Anti-PSMF1 antibody (ab140497)
Key features and details
- Rabbit polyclonal to PSMF1
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PSMF1 antibody
See all PSMF1 primary antibodies -
Description
Rabbit polyclonal to PSMF1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, Bat -
Immunogen
Synthetic peptide corresponding to Human PSMF1 aa 221-271.
Sequence:LIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMY L
Database link: NP_848693.2 -
Positive control
- 293T, HeLa, Jurkat whole cell lysate (ab7899)
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH: 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab140497 was affinity purified using an epitope specific to PSMF1 immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab140497 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/1000 - 1/5000. Predicted molecular weight: 30 kDa.
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/1000 - 1/5000. Predicted molecular weight: 30 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Function
Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28. -
Sequence similarities
Belongs to the proteasome inhibitor PI31 family. - Information by UniProt
-
Database links
- Entrez Gene: 617807 Cow
- Entrez Gene: 9491 Human
- Entrez Gene: 228769 Mouse
- Entrez Gene: 100171902 Orangutan
- Entrez Gene: 689852 Rat
- SwissProt: Q3SX30 Cow
- SwissProt: Q92530 Human
- SwissProt: Q8BHL8 Mouse
see all -
Alternative names
- hPI31 antibody
- PI31 antibody
- Proteasome (prosome macropain) inhibitor subunit 1 antibody
see all
Images
-
All lanes : Anti-PSMF1 antibody (ab140497) at 0.4 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 30 kDa
Exposure time: 3 minutes -
ab140497 at 1 µg/ml detecting PSMF1 in 293T whole cell lysate by WB following IP.
Lane 1: ab140497 at 6µg/mg of lysate
Lane 2: control IgG.
In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.
Detection: Chemiluminescence with an exposure time of 30 seconds.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab140497 has been referenced in 1 publication.
- Liu K et al. PI31 Is an Adaptor Protein for Proteasome Transport in Axons and Required for Synaptic Development. Dev Cell 50:509-524.e10 (2019). PubMed: 31327739