Overview

  • Product name

    Anti-Proteasome maturation protein antibody
    See all Proteasome maturation protein primary antibodies
  • Description

    Rabbit polyclonal to Proteasome maturation protein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human Proteasome maturation protein aa 1-141. Expressed in E.coli. N-terminal tags.
    Sequence:

    MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLEL SEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNL SLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL


    Database link: Q9Y244

  • Positive control

    • WB: Recombinant human Proteasome maturation protein; HeLa cell lysate. IHC-P: Human liver and kidney tissue.
  • General notes

     This product was previously labelled as HSPC014

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 16 kDa.

Target

  • Function

    Molecular chaperone essential for the assembly of standard proteasomes and immunoproteasomes. Degraded after completion of proteasome maturation. Mediates the association of 20S preproteasome with the endoplasmic reticulum.
  • Tissue specificity

    Strongly expressed from the basal layer to the granular layer of healthy epidermis, whereas in KLICK patients there is a gradual decrease of expression toward the granular layer.
  • Involvement in disease

    Defects in POMP are the cause of keratosis linearis with ichthyosis congenita and sclerosing keratoderma (KLICK) [MIM:601952]. KLICK is a keratinizing disorder characterized by ichthyosis, palmoplantar keratoderma with constricting bands around fingers, flexural deformities of fingers and keratotic papules in a linear distribution on the flexural side of large joints. Histological examination of the skin of affected individuals shows hypertrophy and hyperplasia of the spinous, granular and horny epidermal layer.
  • Sequence similarities

    Belongs to the POMP/UMP1 family.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2510048O06Rik antibody
    • C13orf12 antibody
    • Chromosome 13 open reading frame 12 antibody
    • HSPC 014 antibody
    • HSPC036 protein antibody
    • hUMP 1 antibody
    • hUMP1 antibody
    • PNAS 110 antibody
    • PNAS110 antibody
    • Pomp antibody
    • POMP_HUMAN antibody
    • Proteasome maturation protein antibody
    • Proteassemblin antibody
    • Protein UMP1 homolog antibody
    • UMP 1 antibody
    • UMP1 antibody
    • UMP1, yeast, homolog of antibody
    • Voltage gated K channel beta subunit 4.1 antibody
    • Voltage-gated K channel beta subunit 4.1 antibody
    • voltage-gated potassium channel beta subunit 4.1 antibody
    see all

Images

  • Anti-Proteasome maturation protein antibody (ab232900) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 16 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for proteasome maturation protein using ab232900 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for proteasome maturation protein using ab232900 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Proteasome maturation protein antibody (ab232900) at 2 µg/ml + Recombinant human Proteasome maturation protein

    Predicted band size: 16 kDa

References

ab232900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up