Overview

  • Product name

    Anti-Proteasome subunit alpha type 6 antibody
    See all Proteasome subunit alpha type 6 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome subunit alpha type 6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, African green monkey
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Proteasome subunit alpha type 6 aa 1-246.
    Sequence:

    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVI VTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAAN WKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQ VYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAIT CLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD


    Database link: P60900

  • Positive control

    • HepG2, HeLa, HL60, COS7, PC12, MCF7, A375, NCI-H460 and Mouse skeletal muscle extracts.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185731 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 27 kDa.
IHC-P 1/50 - 1/200.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
  • Sequence similarities

    Belongs to the peptidase T1A family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 27 kDa prosomal protein antibody
    • IOTA antibody
    • Macropain iota chain antibody
    • Macropain subunit iota antibody
    • MGC22756 antibody
    • MGC2333 antibody
    • MGC23846 antibody
    • Multicatalytic endopeptidase complex iota chain antibody
    • p27K antibody
    • PROS 27 antibody
    • PROS-27 antibody
    • PROS27 antibody
    • Prosomal P27K protein antibody
    • Proteasome (prosome macropain) subunit alpha type 6 antibody
    • Proteasome iota chain antibody
    • Proteasome subunit alpha type 6 antibody
    • Proteasome subunit alpha type-6 antibody
    • Proteasome subunit iota antibody
    • PSA6_HUMAN antibody
    • PSMA 6 antibody
    • PSMA6 antibody
    see all

Images

  • All lanes : Anti-Proteasome subunit alpha type 6 antibody (ab185731) at 1/500 dilution

    Lane 1 : HepG2 cell line extract
    Lane 2 : HeLa cell line extract
    Lane 3 : HL60 cell line extract
    Lane 4 : COS7 cell line extract
    Lane 5 : PC12 cell line extract
    Lane 6 : MCF7 cell line extract
    Lane 7 : A375 cell line extract
    Lane 8 : NCI-H460 cell line extract
    Lane 9 : Mouse skeletal muscle extract

    Predicted band size: 27 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling Proteasome subunit alpha type 6 with ab185731 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human rectal cancer tissue labelling Proteasome subunit alpha type 6 with ab185731 at 1/200. Magnification: 400x.
  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185731. Blue DAPI for nuclear staining.

References

ab185731 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185731.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up