Overview

  • Product name
    Anti-Proteasome subunit beta type 2 antibody
    See all Proteasome subunit beta type 2 primary antibodies
  • Description
    Rabbit polyclonal to Proteasome subunit beta type 2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Guinea pig, Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome subunit beta type 2 aa 151-201.
    Sequence:

    ISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQG S


    Database link: P49721

  • Positive control
    • Recombinant Human Proteasome subunit beta type 2 protein (ab116169) can be used as a positive control in WB. 293T, HeLa and Jurkat whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab140426 was affinity purified using an epitope specific to PSMB2 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 23 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity.
  • Sequence similarities
    Belongs to the peptidase T1B family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • HC7 I antibody
    • Macropain subunit C7 I antibody
    • Macropain subunit C7-I antibody
    • Multicatalytic endopeptidase complex subunit C7 1 antibody
    • Multicatalytic endopeptidase complex subunit C7 I antibody
    • Multicatalytic endopeptidase complex subunit C7-I antibody
    • Proteasome (prosome, macropain) subunit beta type 2 antibody
    • Proteasome beta 2 subunit antibody
    • Proteasome component C7 I antibody
    • Proteasome component C7-I antibody
    • Proteasome subunit beta type-2 antibody
    • PSB2_HUMAN antibody
    • Psmb2 antibody
    see all

Images

  • All lanes : Anti-Proteasome subunit beta type 2 antibody (ab140426) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 23 kDa


    Exposure time: 30 seconds
  • Detection of PSMB2 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab140426 at 6 µg/mg lysate for IP (Lane 1). Lane 2 represents control IgG IP.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab140426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up