Overview

  • Product name

    Anti-Proteasome subunit beta type 2/PSMB2 antibody
    See all Proteasome subunit beta type 2/PSMB2 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome subunit beta type 2/PSMB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Guinea pig, Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human Proteasome subunit beta type 2/PSMB2 aa 151-201.
    Sequence:

    ISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQG S


    Database link: P49721

  • Positive control

    • Recombinant Human Proteasome subunit beta type 2/PSMB2 protein (ab116169) can be used as a positive control in WB. 293T, HeLa and Jurkat whole cell lysates.
  • General notes

     This product was previously labelled as PSMB2, Proteasome subunit beta type 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab140426 was affinity purified using an epitope specific to Proteasome subunit beta type 2/PSMB2 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 23 kDa.
IP Use at 2-10 µg/mg of lysate.
IHC-P 1/5000.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity.
  • Sequence similarities

    Belongs to the peptidase T1B family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HC7 I antibody
    • Macropain subunit C7 I antibody
    • Macropain subunit C7-I antibody
    • Multicatalytic endopeptidase complex subunit C7 1 antibody
    • Multicatalytic endopeptidase complex subunit C7 I antibody
    • Multicatalytic endopeptidase complex subunit C7-I antibody
    • Proteasome (prosome, macropain) subunit beta type 2 antibody
    • Proteasome beta 2 subunit antibody
    • Proteasome component C7 I antibody
    • Proteasome component C7-I antibody
    • Proteasome subunit beta type-2 antibody
    • PSB2_HUMAN antibody
    • Psmb2 antibody
    see all

Images

  • All lanes : Anti-Proteasome subunit beta type 2/PSMB2 antibody (ab140426) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 23 kDa


    Exposure time: 30 seconds
  • Detection of Proteasome subunit beta type 2/PSMB2 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab140426 at 6 µg/mg lysate for IP (Lane 1). Lane 2 represents control IgG IP.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

  • Immunohistochemistry of human ovarian carcinoma tissue using ab140426 at 1/5000.

References

ab140426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up