Overview

  • Product name

    Anti-Proteasome subunit beta type 2/PSMB2 antibody
    See all Proteasome subunit beta type 2/PSMB2 primary antibodies
  • Description

    Rabbit polyclonal to Proteasome subunit beta type 2/PSMB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Proteasome subunit beta type 2/PSMB2 aa 1-201.
    Sequence:

    MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEA GDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHV NLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPT ISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQG S


    Database link: P49721

  • Positive control

    • WB: EC109 and HEK-293T whole cell lysate. IHC-P: Mouse kidney tissue. ICC/IF: PC-3 cells.
  • General notes

     This product was previously labelled as PSMB2, Proteasome subunit beta type 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 23 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity.
  • Sequence similarities

    Belongs to the peptidase T1B family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HC7 I antibody
    • Macropain subunit C7 I antibody
    • Macropain subunit C7-I antibody
    • Multicatalytic endopeptidase complex subunit C7 1 antibody
    • Multicatalytic endopeptidase complex subunit C7 I antibody
    • Multicatalytic endopeptidase complex subunit C7-I antibody
    • Proteasome (prosome, macropain) subunit beta type 2 antibody
    • Proteasome beta 2 subunit antibody
    • Proteasome component C7 I antibody
    • Proteasome component C7-I antibody
    • Proteasome subunit beta type-2 antibody
    • PSB2_HUMAN antibody
    • Psmb2 antibody
    see all

Images

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for Proteasome subunit beta type 2/PSMB2 (green) using ab236752 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • Paraffin-embedded mouse kidney tissue stained for Proteasome subunit beta type 2/PSMB2 using ab236752 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-Proteasome subunit beta type 2/PSMB2 antibody (ab236752) at 1/500 dilution

    Lane 1 : EC109 whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/15000 dilution

    Predicted band size: 23 kDa

References

ab236752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up