Overview

  • Product name
    Anti-Protein CASP antibody [2A10]
    See all Protein CASP primary antibodies
  • Description
    Mouse monoclonal [2A10] to Protein CASP
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, ICC, WB, IHC-FoFr, ICC/IF, Sandwich ELISA, Flow Cytmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human Protein CASP aa 521-621. NP_001904.2
    Sequence:

    AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELR YSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI


    Database link: Q13948

  • Positive control
    • ICC/IF: HeLa cells. IHC-P: Human spleen tissue; human malignant lymphoma, diffuse large B tissue. Flow Cytometry: MCF7 cells. WB: Protein CASP transfected HEK-293T cell lysate. Recombinant Protein CASP protein.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab54583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
ICC Use at an assay dependent concentration.
WB Use at an assay dependent concentration.
IHC-FoFr Use at an assay dependent concentration. PubMed: 25355226
ICC/IF Use at an assay dependent concentration.
Sandwich ELISA Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Target

Images

  • Formalin-fixed, paraffin-embedded human spleen tissue stained for Protein CASP with ab54583 at 5 µg/ml in immunohistochemical analysis.

    This image was generated using the ascites version of the product.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Protein CASP (green) using ab54583 at 10 µg/ml in ICC/IF.

    This image was generated using the ascites version of the product.

  • Overlay histogram showing MCF7 (human breast adenocarcinoma cell line) cells stained with ab54583 (red line). The cells were fixed with 80% methanol (5 minutes) and then permeabilized with 0.1% PBS-Tween for 20 minutes. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3 M glycine to block non-specific protein-protein interactions followed by the antibody (ab54583, 1 µg/1 x 106 cells) for 30 minutes at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 minutes at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2 µg/1 x 106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in MCF7 cells fixed with 4% paraformaldehyde (10 minutes)/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

  • All lanes : Anti-Protein CASP antibody [2A10] (ab54583) at 5 µg/ml

    Lane 1 : Protein CASP transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate


    This image was generated using the ascites version of the product.

  • Formalin-fixed, paraffin-embedded human malignant lymphoma, diffuse large B tissue stained for Protein CASP with ab54583 at 5 µg/ml in immunohistochemical analysis.

    This image was generated using the ascites version of the product.

  • Anti-Protein CASP antibody [2A10] (ab54583) at 5 µg/ml + Tagged recombinant Protein CASP protein


    This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.

    Expected MW 38 kDa.

    This image was generated using the ascites version of the product.

  • Detection limit of ab54583 is approximately 0.03 ng/ml as a capture antibody.

    This image was generated using the ascites version of the product.

References

This product has been referenced in:
  • Zhang Z  et al. METTL3-mediated N6-methyladenosine mRNA modification enhances long-term memory consolidation. Cell Res N/A:N/A (2018). IHC-Fr ; Mouse . Read more (PubMed: 30297870) »
  • Edri R  et al. Analysing human neural stem cell ontogeny by consecutive isolation of Notch active neural progenitors. Nat Commun 6:6500 (2015). Other ; Human . Read more (PubMed: 25799239) »
See all 10 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-7 of 7 Abreviews

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (cortical neurons)
Permeabilization
Yes - 0.25% Triton X-100 in PBS
Specification
cortical neurons
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 06 2018

Application
Immunohistochemistry free floating
Sample
Mouse Tissue sections (P12 brain sections)
Specification
P12 brain sections

Dr. Bhavin Shah

Verified customer

Submitted Apr 17 2018

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Frozen sections)
Sample
Rabbit Tissue sections (brain)
Permeabilization
Yes - 0.3% triton
Specification
brain
Blocking step
Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Mar 28 2017

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry
Sample
Human Cultured Cells (HeLa)
Permeabilization
Yes - 0.3% Triton-X-100 in PBS
Specification
HeLa
Blocking step
10% normal serum, 1% BSA in PBST as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 22°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted May 02 2013

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Rat Tissue sections (Brain)
Antigen retrieval step
None
Permeabilization
No
Specification
Brain
Fixative
Paraformaldehyde

Dr. Sophie Pezet

Verified customer

Submitted Jun 08 2012

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (brain, placenta)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: EDTA, pH9, 20 min, 100C
Permeabilization
No
Specification
brain, placenta
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Nov 09 2011

Application
Western blot
Sample
Human Cell lysate - whole cell (MDA-MB-231, HT-1080, NIH3T3, D283Med, Daoy)
Gel Running Conditions
Reduced Denaturing (8%gel)
Loading amount
500000 cells
Specification
MDA-MB-231, HT-1080, NIH3T3, D283Med, Daoy
Blocking step
3% non fat milk/ 2% BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Ms. Sabine Topka

Verified customer

Submitted Oct 07 2009

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up