Overview

  • Product name
    Anti-proteinC antibody
  • Description
    Rabbit polyclonal to proteinC
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human proteinC aa 280-461.
    Sequence:

    LDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERE LNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSN MVSENMLCAGILGDRQDACE GDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHI RDKEAPQKSW AP


    Database link: P04070

  • Positive control
    • ES-2 cell line extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab180733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 52 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.
  • Tissue specificity
    Plasma; synthesized in the liver.
  • Involvement in disease
    Thrombophilia due to protein C deficiency, autosomal dominant
    Thrombophilia due to protein C deficiency, autosomal recessive
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 2 EGF-like domains.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    The vitamin K-dependent, enzymatic carboxylation of some Glu residues allows the modified protein to bind calcium.
    N- and O-glycosylated. Partial (70%) N-glycosylation of Asn-371 with an atypical N-X-C site produces a higher molecular weight form referred to as alpha. The lower molecular weight form, not N-glycosylated at Asn-371, is beta. O-glycosylated with core 1 or possibly core 8 glycans.
    The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
    May be phosphorylated on a Ser or Thr in a region (AA 25-30) of the propeptide.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activation peptide antibody
    • Anticoagulant protein C antibody
    • Autoprothrombin IIA antibody
    • Blood coagulation factor XIV antibody
    • proC antibody
    • PROC_HUMAN antibody
    • Vitamin K-dependent protein C antibody
    see all

Images

  • Anti-proteinC antibody (ab180733) at 1/500 dilution + ES-2 cell line extract

    Predicted band size: 52 kDa

References

ab180733 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up