Anti-Prothrombin fragment 2 antibody (ab233297)

Overview

  • Product name

    Anti-Prothrombin fragment 2 antibody
  • Description

    Rabbit polyclonal to Prothrombin fragment 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Prothrombin fragment 2 aa 44-327. Expressed in E. coli. N-terminal His-tag and GST-tag.
    Sequence:

    ANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETA RTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKPEIN STTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTV AMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAK ALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEE AVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPR


    Database link: P00734

  • Positive control

    • WB: Recombinant human Prothrombin fragment 2 protein. HEK-293T cell lysate. Pig kidney tissue lysate. Rat serum. IHC-P: Human prostate cancer, pancreatic cancer, colorectal cancer, bile duct cancer and skin cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab233297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Images

  • All lanes : Anti-Prothrombin fragment 2 antibody (ab233297) at 2 µg/ml

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Pig kidney tissue lysate
    Lane 3 : Rat serum

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for Prothrombin fragment 2 with ab233297 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human bile duct cancer tissue stained for Prothrombin fragment 2 with ab233297 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for Prothrombin fragment 2 with ab233297 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for Prothrombin fragment 2 with ab233297 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for Prothrombin fragment 2 with ab233297 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-Prothrombin fragment 2 antibody (ab233297) at 2 µg/ml + Recombinant human Prothrombin fragment 2 protein

References

ab233297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up