Overview

  • Product name

    Anti-Protocadherin Gamma (pan) antibody [N159/5] - C-terminal
  • Description

    Mouse monoclonal [N159/5] to Protocadherin Gamma (pan) - C-terminal
  • Host species

    Mouse
  • Specificity

    Cross-reacts with all Gamma- protocadherin-A, -B and -C proteins.
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-P, IHC-Frmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Fusion protein corresponding to Mouse Protocadherin Gamma (pan) aa 808-931 (C terminal). The immunogens sequence is shared by all 22 Gamma-protocadherins (A subfamily amino acids ~807-930, B subfamily amino acids ~789- 912 and C subfamily amino acids ~818-941).
    Sequence:

    QAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASE AADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAA GKRDGKAPAGGNGNKKKSGK KEKK


    Database link: NP_291062.1

  • Positive control

    • Rat brain lysate.
  • General notes

    The clone number has been updated from S159-5 to N159/5, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab187186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100.
WB 1/1000.
IHC-P Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.

Images

  • Anti-Protocadherin Gamma (pan) antibody [N159/5] - C-terminal (ab187186) at 1/1000 dilution + Rat brain membrane lysate at 10 µg

    Secondary
    Goat Anti-Mouse HRP at 1/200 dilution
  • Ab187186 staining Protocadherin gamma (pan) in SK-N-BE cells by Immunocytochemistry/Immunofluorescence (ICC/IF).  Cells were fixed with 4% formaldehyde for 15 minutes at room temperature. Samples were incubated wth pirmary antibody at 1/100 dilution for 60 minutes at room temperature. Phalliodin Texas Red F-Actin (1/1000) was used as a counterstain at 1/1000 dilution. DAPI nuclear counterstain was used at 1/5000 dilution.

References

This product has been referenced in:

  • Kaur G  et al. Alternative splicing of helicase-like transcription factor (Hltf): Intron retention-dependent activation of immune tolerance at the feto-maternal interface. PLoS One 13:e0200211 (2018). Read more (PubMed: 29975766) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up