ProTx-I, CaV3.1 channel blocker. Inhibits NaV1 and KV2.1 channels. (ab141863)


  • Product name

    ProTx-I, CaV3.1 channel blocker. Inhibits NaV1 and KV2.1 channels.
  • Description

    Potent, selective CaV3.1 channel blocker. Inhibits NaV1 and KV2.1 channels.
  • Biological description

    Potent, selective CaV3.1 channel blocker (IC50 values are 0.2 and 32 μM for CaV3.1 and CaV3.2 respectively). Reversibly inhibits all NaV1 subtypes by modifying gating kinetics similar to ProTx-II (Asc 1880). Blocks KV2.1 channels. Shows proliferative effects.
  • Purity

    > 98%
  • Chemical structure

    Chemical Structure


  • Molecular weight

  • Molecular formula

  • Sequence

    ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS (Modifications: Disulfide bonds: 2-16, 9-21, 15-28)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Thrixopelma pruriens

  • Research areas


This product has been referenced in:

  • Ohkubo T & Yamazaki J T-type voltage-activated calcium channel Cav3.1, but not Cav3.2, is involved in the inhibition of proliferation and apoptosis in MCF-7 human breast cancer cells. Int J Oncol 41:267-75 (2012). Read more (PubMed: 22469755) »
  • Ohkubo T  et al. Tarantula toxin ProTx-I differentiates between human T-type voltage-gated Ca2+ Channels Cav3.1 and Cav3.2. J Pharmacol Sci 112:452-8 (2010). Read more (PubMed: 20351484) »
  • Priest BT  et al. ProTx-I and ProTx-II: gating modifiers of voltage-gated sodium channels. Toxicon 49:194-201 (2007). Read more (PubMed: 17087985) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141863.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact

Sign up