Overview

  • Product name

    ProTx-II, NaV1 channel blocker
  • Description

    Potent, selective NaV1 channel blocker
  • Biological description

    Potent, selective NaV1 channel blocker (IC50 values are 0.3 and 30-150 nM for NaV1.7 and other NaV1 subtypes respectively). Acts as a gating modifier similar to ProTX-I (Asc 1863) and shifts the voltage dependence of activation to more depolarized potentials. Selectively blocks the C-fibre compound action potential in vivo.
  • Purity

    > 98%
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    3832.60
  • Molecular formula

    C168H256N46O41S8
  • Sequence

    YCQKWMWTCDSERKCCEGMVCRLWCKKKLW (Modifications: Disulfide bonds: 2-16, 9-21, 15-25)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Thrixopelma pruriens

  • Research areas

References

This product has been referenced in:

  • Schmalhofer WA  et al. ProTx-II, a selective inhibitor of NaV1.7 sodium channels, blocks action potential propagation in nociceptors. Mol Pharmacol 74:1476-84 (2008). Read more (PubMed: 18728100) »
  • Priest BT  et al. ProTx-I and ProTx-II: gating modifiers of voltage-gated sodium channels. Toxicon 49:194-201 (2007). Read more (PubMed: 17087985) »
  • Smith JJ  et al. Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation. J Biol Chem 282:12687-97 (2007). Read more (PubMed: 17339321) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up