Overview

  • Product name

    Anti-PRR11 antibody [OTI1A4]
    See all PRR11 primary antibodies
  • Description

    Mouse monoclonal [OTI1A4] to PRR11
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PRR11 aa 125-360. (NP_060774) produced in E.coli.
    Sequence:

    MPKFKQRRRKLKAKAERLFKKKEASHFQSKLITPPPPPPSPERVGISSID ISQSRSWLTSSWNFNFPNIRDAIKLWTNRVWSIYSWCQNCITQSLEVLKD TIFPSRICHRELYSVKQQFCILESKLCKLQEALKTISESSSCPSCGQTCH MSGKLTNVPACVLITPGDSKAVLPPTLPQPASHFPPPPPPPPLPPPPPPL APVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLI PSPKARNPLVTVSDLQHVTLKPNSKVLSTRVTNVLITPGKSQMDLRKLLR KVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLP LSTSSFDEQN


    Database link: Q96HE9

  • Positive control

    • WB: HEK-293T cells transfected with pCMV6-ENTRY PRR11 cDNA; HepG2, HeLa, SVT2, A549, COS-7, jurkat, MDCK, PC-12 and MCF7 whole cell lysate.
  • General notes

    The clone number has been updated from 1A4 to OTI1A4, both clone numbers name the same clone.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI1A4
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab131652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution. Predicted molecular weight: 40 kDa.

Target

  • Post-translational
    modifications

    Ubiquitinated (Probable). Rapidly degraded by the proteasome; degradation may involve FBXW7-specific phosphorylated phosphodegron motifs.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ11029 antibody
    • Homo sapiens proline rich 11 antibody
    • Proline rich protein 11 antibody
    • Proline-rich protein 11 antibody
    • PRR 11 antibody
    • Prr11 antibody
    • PRR11_HUMAN antibody
    • transcription repressor of MHCII antibody
    see all

Images

  • All lanes : Anti-PRR11 antibody [OTI1A4] (ab131652) at 1/2000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : SVT2 whole cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) whole cell lysate
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 7 : MDCK whole cell lysate
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) whole cell lysate
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Predicted band size: 40 kDa

  • All lanes : Anti-PRR11 antibody [OTI1A4] (ab131652)

    Lane 1 : HEK293T cells transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK293T cells transfected with pCMV6-ENTRY PRR11 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 40 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC201889)

References

ab131652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up