Overview

  • Product name

    Anti-PRR14L antibody
  • Description

    Rabbit polyclonal to PRR14L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PRR14L aa 1120-1213.
    Sequence:

    ASTVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRIL GRVNLSLNDSHYGQQDKGTSLRETQEMTEGSRLEPNSEFGKEST


    Database link: Q5THK1

  • Positive control

    • SiHa cells, Human cerebral cortex tissue
  • General notes

    Previously labelled as C22ORF30.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab204889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunofluorescent analysis of PFA/Triton X-100 fixed and permeabilized SiHa cells labeling  ab204889 at 4 µg/mL. Antibody staining is shown in green.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human cerebral cortex labeling PRR14L with ab204889 at 1/500.

References

ab204889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up