Overview

  • Product name

  • Description

    Rabbit polyclonal to PRRC2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PRRC2B aa 778-877.
    Sequence:

    SSFSASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQ ELLFPPQENVQDAGAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQP


    Database link: Q5JSZ5

  • Positive control

    • SiHa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • 5830434P21Rik antibody
    • AI173903 antibody
    • Bat2l antibody
    • BAT2L1 antibody
    • D430039P21 antibody
    • DKFZp781F05101 antibody
    • DKFZp781K12107 antibody
    • HLA B associated transcript 2 like antibody
    • HLA-B-associated transcript 2-like 1 antibody
    • KIAA0515 antibody
    • LQFBS 1 antibody
    • MGC10526 antibody
    • mKIAA0515 antibody
    • OTTMUSP00000013926 antibody
    • OTTMUSP00000013927 antibody
    • PRC2B_HUMAN antibody
    • Proline rich coiled coil 2B antibody
    • Proline-rich coiled-coil protein 2B antibody
    • Protein BAT2 like 1 antibody
    • Protein PRRC2B antibody
    • PRRC2B antibody
    • RP11-334J6.1, BAT2L, BAT2L1, , LQFBS 1 antibody
    • RP23-161B9.1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SiHa cells labeling PRRC2B with ab221468 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab221468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up