Overview

  • Product name

    Anti-PRRT2 antibody [CL4233]
    See all PRRT2 primary antibodies
  • Description

    Mouse monoclonal [CL4233] to PRRT2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PRRT2 aa 152-268.
    Sequence:

    PPKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEP HSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQ LAGPGVEGGEGTQKPRDY


    Database link: Q7Z6L0

  • Positive control

    • Human cerebral cortex and cerebellum tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL4233
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Involvement in disease

    Episodic kinesigenic dyskinesia 1 (EKD1) [MIM:128200]: An autosomal dominant neurologic condition characterized by recurrent and brief attacks of abnormal involuntary movements, triggered by sudden voluntary movement. These attacks usually have onset during childhood or early adulthood and can involve dystonic postures, chorea, or athetosis. Note=The disease is caused by mutations affecting the gene represented in this entry. Disease-causing mutations that produce truncation of the C-terminus of the protein alter subcellular location, from plasma membrane to cytosplasm (PubMed:22101681).
    Convulsions, familial infantile, with paroxysmal choreoathetosis (ICCA) [MIM:602066]: A syndrome characterized by clinical features of benign familial infantile seizures and episodic kinesigenic dyskinesia. Benign familial infantile seizures is a disorder characterized by afebrile seizures occurring during the first year of life, without neurologic sequelae. Paroxysmal choreoathetosis is a disorder of involuntary movements characterized by attacks that occur spontaneously or are induced by a variety of stimuli. Note=The disease is caused by mutations affecting the gene represented in this entry.
    Seizures, benign familial infantile 2 (BFIS2) [MIM:605751]: An autosomal dominant disorder in which afebrile seizures occur in clusters during the first year of life, without neurologic sequelae. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the CD225/Dispanin family.
  • Cellular localization

    Cell membrane. Cell junction > synapse.
  • Information by UniProt
  • Database links

  • Alternative names

    • interferon induced transmembrane protein domain containing 1 antibody
    • BFIC2 antibody
    • BFIS2 antibody
    • Dispanin subfamily B member 3 antibody
    • DSPB3 antibody
    • Dystonia 10 antibody
    • DYT10 antibody
    • EKD1 antibody
    • FICCA antibody
    • FLJ25513 antibody
    • ICCA antibody
    • IFITMD1 antibody
    • Infantile convulsions and paroxysmal choreoathetosis antibody
    • PKC antibody
    • Proline rich transmembrane protein 2 antibody
    • Proline-rich transmembrane protein 2 antibody
    • PRRT2 antibody
    • PRRT2_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling PRRT2 with ab219960 at 1/5000 dilution.

  • Immunohistochemical analysis of paraffin-embedded human cerebellum tissue labeling PRRT2 with ab219960 at 1/5000 dilution.

References

This product has been referenced in:

  • Mo J  et al. PRRT2 deficiency induces paroxysmal kinesigenic dyskinesia by influencing synaptic function in the primary motor cortex of rats. Neurobiol Dis 121:274-285 (2019). Read more (PubMed: 30347267) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up