Overview

  • Product name

  • Description

    Rabbit polyclonal to PRSS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PRSS2 aa 24-247. Immunogen corresponds to the full-length mature protein from aa 24 to 247. The signal and propeptide are not included.
    Sequence:

    IVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRL GEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRV SAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEA SYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQK NRPGVYTKVYNYVDWIKDTIAANS


    Database link: P07478

  • Positive control

    • WB: Mouse heart, liver, brain and kidney tissue lysates. IHC-P: Human small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 27 kDa (predicted molecular weight: 27 kDa).
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Sulfated on tyrosine.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • Anionic trypsinogen antibody
    • EC 3.4.21.4 antibody
    • MGC111183 antibody
    • MGC120174 antibody
    • Protease serine 2 preproprotein antibody
    • Protease, serine, 2 (trypsin 2) antibody
    • Protease, serine, 2 antibody
    • Protease, serine, 2, preproprotein antibody
    • Prss2 antibody
    • Serine protease 2 antibody
    • TRY2 antibody
    • TRY2_HUMAN antibody
    • TRY8 antibody
    • TRYP2 antibody
    • Trypsin 2 antibody
    • Trypsin II antibody
    • Trypsin-2 antibody
    • Trypsinogen 2 antibody
    see all

Images

  • All lanes : Anti-PRSS2 antibody (ab223064) at 1/500 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse brain tissue lysate
    Lane 4 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat Ant-Rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa
    Observed band size: 27 kDa

  • Paraffin-embedded human small intestine tissue stained for PRSS2 using ab223064 at 1/100 in immunohistochemical analysis.

References

ab223064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up