Overview

  • Product name

  • Description

    Rabbit polyclonal to PRSS22
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PRSS22 aa 87-291. (BC009726).
    Sequence:

    TAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKE GACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDG VPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERD ACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVE KIVQG


    Database link: Q9GZN4

  • Positive control

    • Human fetal lung lysate; Human fetal pancreas tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200 uL sterile water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 34 kDa.

Target

  • Relevance

    PRSS22 is a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. It preferentially cleaves the synthetic substrate H-D-Leu-Thr-Arg-pNA compared to tosyl-Gly-Pro-Arg-pNA.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Brain specific serine protease 4 antibody
    • BSSP 4 antibody
    • BSSP4 antibody
    • hBSSP 4 antibody
    • MGC9599 antibody
    • Prosemin antibody
    • Protease serine 22 antibody
    • Protease serine S1 family member 22 antibody
    • PRSS 22 antibody
    • PRSS26 antibody
    • Serine protease 22 antibody
    • Serine protease 26 antibody
    • SP001LA antibody
    • Tryptase epsilon antibody
    see all

Images

  • Anti-PRSS22 antibody (ab197158) at 1/1000 dilution + Human fetal lung lysate

    Predicted band size: 34 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal pancreas tissue labeling PRSS22 with ab197158 at 1/100 dilution.

References

ab197158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up