Overview

  • Product name

  • Description

    Rabbit polyclonal to PRSS23
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
    Predicted to work with: Cow, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human PRSS23 aa 35-189. BC001278.
    Sequence:

    YRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQY LSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKSRRKRQIYGYD SRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYV KGTQK


    Database link: O95084

  • Positive control

    • Human fetal liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 43 kDa.

Target

Images

  • Anti-PRSS23 antibody (ab201182) at 1/1000 dilution + Human recombinant protein.

    Predicted band size: 43 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal liver tissue labeling PRSS23 with ab201182 at 1/100 dilution.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up