Overview

  • Product name

    Anti-PRSS3/Mesotrypsin antibody
    See all PRSS3/Mesotrypsin primary antibodies
  • Description

    Rabbit polyclonal to PRSS3/Mesotrypsin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human PRSS3/Mesotrypsin aa 71-120 (N terminal).
    Sequence:

    VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH


    Database link: NP_031369

  • Positive control

    • Human fetal muscle lysate
  • General notes

     This product was previously labelled as PRSS3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab105123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.
  • Tissue specificity

    Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Brain trypsinogen antibody
    • Mesotrypsin antibody
    • Mesotrypsinogen antibody
    • MTG antibody
    • Pancreatic trypsinogen III antibody
    • Protease, serine, 3 antibody
    • Protease, serine, 4 (trypsin 4, brain) antibody
    • PRSS3 antibody
    • PRSS4 antibody
    • Serine protease 3 antibody
    • Serine protease 4 antibody
    • T9 antibody
    • TRY3 antibody
    • TRY3_HUMAN antibody
    • TRY4 antibody
    • Trypsin 3 antibody
    • Trypsin III antibody
    • Trypsin IV antibody
    • Trypsin-3 antibody
    • Trypsinogen 4 antibody
    • Trypsinogen 5 antibody
    • Trypsinogen IV antibody
    see all

Images

  • Anti-PRSS3/Mesotrypsin antibody (ab105123) at 1 µg/ml + Human fetal muscle lysate at 10 µg

    Predicted band size: 33 kDa



    Gel concentration: 12%

References

ab105123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up