For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    prss8-antibody-ab200736.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Proteolysis / Ubiquitin Proteolytic enzymes Other proteases
Share by email

Anti-PRSS8 antibody (ab200736)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-PRSS8 antibody (ab200736)

    Key features and details

    • Rabbit polyclonal to PRSS8
    • Suitable for: WB
    • Reacts with: Mouse, Rat, Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-PRSS8 antibody
      See all PRSS8 primary antibodies
    • Description

      Rabbit polyclonal to PRSS8
    • Host species

      Rabbit
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Mouse, Rat, Human
    • Immunogen

      Synthetic peptide corresponding to Human PRSS8 aa 35-80.
      Sequence:

      APCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWV


      Database link: Q16651
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • HEK293T, RAW 264.7 and PC12 whole cell lysates.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.20
      Preservative: 0.0975% Sodium azide
      Constituent: 99% PBS
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Purification notes

      Purity is > 95% (by SDS-PAGE).
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Cell Biology
      • Proteolysis / Ubiquitin
      • Proteolytic enzymes
      • Other proteases

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Positive Controls

      • RAW 264.7 whole cell lysate (ab7187)

    Applications

    Our Abpromise guarantee covers the use of ab200736 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use at an assay dependent concentration. Predicted molecular weight: 36 kDa.

    Target

    • Function

      Possesses a trypsin-like cleavage specificity.
    • Tissue specificity

      Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid.
    • Sequence similarities

      Belongs to the peptidase S1 family.
      Contains 1 peptidase S1 domain.
    • Cellular localization

      Cell membrane and Secreted > extracellular space. Found in the seminal fluid. Secreted after cleavage of its C-terminus.
    • Target information above from: UniProt accession Q16651 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 5652 Human
      • Entrez Gene: 76560 Mouse
      • Entrez Gene: 192107 Rat
      • Omim: 600823 Human
      • SwissProt: Q16651 Human
      • SwissProt: Q9ESD1 Mouse
      • SwissProt: Q9ES87 Rat
      • Unigene: 75799 Human
      • Unigene: 5875 Mouse
      • Unigene: 107364 Rat
      see all
    • Alternative names

      • 2410039E18Rik antibody
      • AI313909 antibody
      • C79772 antibody
      • CAP1 antibody
      • Channel Activating Protease 1 antibody
      • mCAP1 antibody
      • Prostasin antibody
      • Prostasin heavy chain antibody
      • protease, serine, 8 antibody
      • Prss8 antibody
      • PRSS8_HUMAN antibody
      • Serine protease 8 antibody
      see all

    Images

    • Western blot - Anti-PRSS8 antibody (ab200736)
      Western blot - Anti-PRSS8 antibody (ab200736)
      All lanes : Anti-PRSS8 antibody (ab200736)

      Lane 1 : HEK293T whole cell lysate
      Lane 2 : RAW 264.7 whole cell lysate
      Lane 3 : PC12 whole cell lysate

      Predicted band size: 36 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab200736? Please let us know so that we can cite the reference in this datasheet.

    ab200736 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab200736.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.