Anti-PRSS8 antibody (ab200736)
Key features and details
- Rabbit polyclonal to PRSS8
- Suitable for: WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-PRSS8 antibody
See all PRSS8 primary antibodies -
Description
Rabbit polyclonal to PRSS8 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide corresponding to Human PRSS8 aa 35-80.
Sequence:APCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWV
Database link: Q16651 -
Positive control
- HEK293T, RAW 264.7 and PC12 whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.0975% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Purity is > 95% (by SDS-PAGE). -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab200736 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use at an assay dependent concentration. Predicted molecular weight: 36 kDa. |
Target
-
Function
Possesses a trypsin-like cleavage specificity. -
Tissue specificity
Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid. -
Sequence similarities
Belongs to the peptidase S1 family.
Contains 1 peptidase S1 domain. -
Cellular localization
Cell membrane and Secreted > extracellular space. Found in the seminal fluid. Secreted after cleavage of its C-terminus. - Information by UniProt
-
Database links
- Entrez Gene: 5652 Human
- Entrez Gene: 76560 Mouse
- Entrez Gene: 192107 Rat
- Omim: 600823 Human
- SwissProt: Q16651 Human
- SwissProt: Q9ESD1 Mouse
- SwissProt: Q9ES87 Rat
- Unigene: 75799 Human
see all -
Alternative names
- 2410039E18Rik antibody
- AI313909 antibody
- C79772 antibody
see all
Images
Datasheets and documents
References (0)
ab200736 has not yet been referenced specifically in any publications.