Overview

  • Product name

  • Description

    Rabbit polyclonal to PRSS8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human PRSS8 aa 80-130 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    VLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQE G


    Database link: Q16651

  • Positive control

    • Human lung carcinoma, kidney and prostate cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

WB 1/100 - 1/1000. Predicted molecular weight: 36 kDa.

Target

  • Function

    Possesses a trypsin-like cleavage specificity.
  • Tissue specificity

    Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Cell membrane and Secreted > extracellular space. Found in the seminal fluid. Secreted after cleavage of its C-terminus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2410039E18Rik antibody
    • AI313909 antibody
    • C79772 antibody
    • CAP1 antibody
    • Channel Activating Protease 1 antibody
    • mCAP1 antibody
    • Prostasin antibody
    • Prostasin heavy chain antibody
    • protease, serine, 8 antibody
    • Prss8 antibody
    • PRSS8_HUMAN antibody
    • Serine protease 8 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human lung carcinoma tissue, labeling PRSS8 using ab203879 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human kidney tissue, labeling PRSS8 using ab203879 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human prostate cancer tissue, labeling PRSS8 using ab203879 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Rostampour N  et al. Expression of new genes in vertebrate tooth development and p63 signaling. Dev Dyn N/A:N/A (2019). Read more (PubMed: 30875130) »
  • Zhang L  et al. PRSS8 is Downregulated and Suppresses Tumour Growth and Metastases in Hepatocellular Carcinoma. Cell Physiol Biochem 40:757-769 (2016). Read more (PubMed: 27915333) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up