Overview

  • Product name

    Anti-PsbQ antibody
  • Description

    Rabbit polyclonal to PsbQ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Tobacco
  • Immunogen

    Recombinant full length protein corresponding to PsbQ. The immunogen species is Spinacia oleracea (Spinach).
    Sequence:

    MAQAMASMAGLRGASQAVLEGSLQISGSNRLSGPTTSRVAVPKMGLNIRA QQVSAEAETS RRAMLGFVAAGLASGSFVKAVLAEARPIVVGPPPPLSG GLPGTENSDQARDGTLPYTKDR FYLQPLPPTEAAQRAKVSASEILNVK QFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKP KDEKKSLQELTSKL FSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG


    Database link: P12301

  • Positive control

    • Chloroplast proteins from tomato (Lycopersicum esculentum); spinach (Spinacia oleracea), tobacco (Nicotiana tabacum) and membrane proteins from Synechocystis sp. PCC 6803.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.01% Sodium azide
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab65568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 25 kDa.

Target

  • Relevance

    PsbQ, also known as 16 kDa protein, is one of the three components (PsbO, PsbP and PsbQ) of oxygen evolving complex (OEC) in higher plants. The cyanobacterial photosystem II have five associated extrinsic proteins, PsbO, PsbP, PsbQ, PsbU and PsbV. This class of subunits is located on the lumen face of the thylakoid membranes. PsbQ has a regulatory role on the water oxidation machinery. The lack of PsbQ in cyanobacteria affects the stability of PsbV protein; and it is likely that the major function of cyanobacterial PsbQ is to stabilize the PsbV protein, thereby contributing to the protection of the catalytic Mn(4)-Ca(1)-Cl(x) cluster of the water oxidation machinery.
  • Cellular localization

    Plastid, chloroplast thylakoid membrane
  • Alternative names

    • 16 kDa subunit of oxygen evolving system of photosystem II antibody
    • OEC 16 kDa subunit antibody
    • OEC16 antibody
    • OEE3 antibody
    • OXYGEN EVOLVING COMPLEX SUBUNIT 16 KDA antibody
    • Oxygen-evolving enhancer protein 3 1, chloroplast antibody
    • Oxygen-evolving enhancer protein 3 2, chloroplast antibody
    • Oxygen-evolving enhancer protein 3, chloroplastic antibody
    • PSBQ 1 antibody
    • PSBQ antibody
    • PSBQ/PSBQ 1/PSBQA PSBQ/PSBQ 1/PSBQA; calcium ion binding antibody
    • PSBQ1 antibody
    • PSBQ2 antibody
    • PSBQA antibody
    • PSII Q antibody
    • T6K22.20 antibody
    see all

References

This product has been referenced in:

  • Rodríguez-Herva JJ  et al. A bacterial cysteine protease effector protein interferes with photosynthesis to suppress plant innate immune responses. Cell Microbiol 14:669-81 (2012). Read more (PubMed: 22233353) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab65568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up