Anti-PSCA antibody (ab202966)
Key features and details
- Rabbit polyclonal to PSCA
- Suitable for: IHC-P
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-PSCA antibody
See all PSCA primary antibodies -
Description
Rabbit polyclonal to PSCA -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Synthetic peptide within Human PSCA aa 5-55 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:LLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIR A
Database link: O43653 -
Positive control
- Rat testis and brain tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab202966 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Use at 1/50 - 1/200 with fluorescent detection methods. |
Target
-
Relevance
PSCA (Prostate Stem Cell antigen) is a cell surface antigen, which is overexpressed in ~40% of primary prostate cancers and in as many as 100% of metastatic ones. PSCA is also overexpressed in a majority of transitional cell and pancreatic carcinomas. Antibody directed against PSCA inhibits tumorigenesis, slows tumor growth, prolongs survival and prevents metastasis in a preclinical zenograft model indicating that PSCA may have utility as a prognostic marker and/or therapeutic target in prostate cancer. -
Cellular localization
Cell membrane; Lipid-anchor, GPI-anchor. -
Database links
- Entrez Gene: 8000 Human
- Entrez Gene: 680210 Rat
- Omim: 602470 Human
- SwissProt: O43653 Human
- Unigene: 652235 Human
- Unigene: 230062 Rat
-
Alternative names
- PRO 232 antibody
- PRO232 antibody
- Prostate stem cell antigen antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSCA antibody (ab202966)
Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat brain tissue labeling PSCA with ab202966 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSCA antibody (ab202966)
Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat testis tissue labeling PSCA with ab202966 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab202966 has not yet been referenced specifically in any publications.