Anti-PSCA antibody (ab202966)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PSCA antibody
See all PSCA primary antibodies -
Description
Rabbit polyclonal to PSCA -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Synthetic peptide within Human PSCA aa 5-55 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:LLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIR A
Database link: O43653 -
Positive control
- Rat testis and brain tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab202966 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Use at 1/50 - 1/200 with fluorescent detection methods. |
Target
-
Relevance
PSCA (Prostate Stem Cell antigen) is a cell surface antigen, which is overexpressed in ~40% of primary prostate cancers and in as many as 100% of metastatic ones. PSCA is also overexpressed in a majority of transitional cell and pancreatic carcinomas. Antibody directed against PSCA inhibits tumorigenesis, slows tumor growth, prolongs survival and prevents metastasis in a preclinical zenograft model indicating that PSCA may have utility as a prognostic marker and/or therapeutic target in prostate cancer. -
Cellular localization
Cell membrane; Lipid-anchor, GPI-anchor. -
Database links
- Entrez Gene: 8000 Human
- Entrez Gene: 680210 Rat
- Omim: 602470 Human
- SwissProt: O43653 Human
- Unigene: 652235 Human
- Unigene: 230062 Rat
-
Alternative names
- PRO 232 antibody
- PRO232 antibody
- Prostate stem cell antigen antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSCA antibody (ab202966)Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat brain tissue labeling PSCA with ab202966 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSCA antibody (ab202966)Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat testis tissue labeling PSCA with ab202966 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Protocols
Datasheets and documents
References
ab202966 has not yet been referenced specifically in any publications.
