Overview

  • Product name
  • Description
    Rabbit polyclonal to PSF3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cat, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human PSF3 aa 166-216. The exact sequence is proprietary. (NP_073607.2).
    Sequence:

    ARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDME D


    Database link: Q9BRX5

  • Positive control
    • 293T, HeLa and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab177515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 24 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • Detection of PSF3 in Immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab177515 at 6 µg/mg lysate for IP and at 0.1 µg/ml for subsequent western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 3 minutes.

  • All lanes : Anti-PSF3 antibody (ab177515) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 24 kDa


    Exposure time: 3 minutes

References

This product has been referenced in:
  • Moiseeva T  et al. ATR kinase inhibition induces unscheduled origin firing through a Cdc7-dependent association between GINS and And-1. Nat Commun 8:1392 (2017). Read more (PubMed: 29123096) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up