Overview

  • Product name

  • Description

    Rabbit polyclonal to PSG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PSG1 aa 202-401. N-terminal tags. Expressed in E.coli.
    Sequence:

    LFLLGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNP RENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVT RNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLY LSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSAT


    Database link: P11464

  • Positive control

    • IHC-P: Human liver, breast cancer and colorectal cancer tissue. WB: Recombinant human PSG1 protein; HeLa cell lysate; Mouse kidney and breast cancer lysate.
  • General notes

     This product was previously labelled as Pregnancy Specific Glycoprotein 1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Sequence similarities

    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    PSBG are produced in high quantity during pregnancy.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • B1G1 antibody
    • Carcinoembryonic antigen SG8 antibody
    • CD66 antigen-like family member F antibody
    • CD66f antibody
    • CD66f antigen antibody
    • CEA antibody
    • DHFRP2 antibody
    • Fetal liver non-specific cross-reactive antigen 1/2 antibody
    • FL-NCA-1/2 antibody
    • PBG 1 antibody
    • PBG1 antibody
    • Pregnancy specific B 1 glycoprotein antibody
    • Pregnancy specific beta 1 glycoprotein 1 antibody
    • Pregnancy specific beta 1 glycoprotein 2 antibody
    • Pregnancy specific beta 1 glycoprotein 7 antibody
    • Pregnancy specific beta 1 glycoprotein 8 antibody
    • Pregnancy specific beta 1 glycoprotein antibody
    • Pregnancy specific beta 1 glycoprotein C/D antibody
    • Pregnancy-specific beta-1 glycoprotein C/D antibody
    • Pregnancy-specific beta-1-glycoprotein 1 antibody
    • Pregnancy-specific glycoprotein 1 antibody
    • PS beta C/D antibody
    • PS-beta-C/D antibody
    • PS-beta-G-1 antibody
    • PSBG 1 antibody
    • PSBG 2 antibody
    • PSBG-1 antibody
    • PSBG1 antibody
    • PSBG2 antibody
    • PSG 1 antibody
    • PSG 2 antibody
    • PSG 8 antibody
    • PSG 95 antibody
    • PSG IIA d antibody
    • PSG1 antibody
    • PSG1_HUMAN antibody
    • PSG2 antibody
    • PSG8 antibody
    • PSG95 antibody
    • PSGGA antibody
    • PSGGB antibody
    • PSGIIA a antibody
    • PSGIIA antibody
    • PSGIIA b antibody
    • PSGIIA c antibody
    • SP 1 antibody
    • SP1 antibody
    see all

Images

  • All lanes : Anti-PSG1 antibody (ab233130) at 3 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Mouse kidney tissue lysate
    Lane 3 : Mouse breast cancer tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for PSG1 using ab233130 at 10 µg/mL in immunohistochemical analysis.

    Secondary antibody used HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for PSG1 using ab233130 at 10 µg/mL in immunohistochemical analysis.

    Secondary antibody used HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PSG1 using ab233130 at 10 µg/mL in immunohistochemical analysis.

    Secondary antibody used HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-PSG1 antibody (ab233130) at 3 µg/ml + Recombinant human PSG1 protein

References

ab233130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up