Overview

  • Product name

  • Description

    Rabbit polyclonal to PSG3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human PSG3 aa 181-226.
    Sequence:

    WMNGQSLPMTHSLQLSKNKRTLFLFGVTKYTAGPYECEIRNPVSAS


    Database link: Q16557

  • Positive control

    • HEK293T, Raw264.7 and PC12 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.097% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab200644 was purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 48 kDa.

Target

  • Relevance

    The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes. Members of the CEA family consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. Most PSGs have an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • carcinoembryonic antigen SG5 antibody
    • pregnancy specific beta-1-glycoprotein 3 antibody
    • Pregnancy specific glycoprotein 3 antibody
    • PS-beta-G-3 antibody
    • PSBG 3 antibody
    • PSBG3 antibody
    see all

Images

  • All lanes : Anti-PSG3 antibody (ab200644)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Raw264.7 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 48 kDa

References

ab200644 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up