Overview

  • Product name

  • Description

    Rabbit polyclonal to PSGL-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human PSGL-1 aa 15-64 (N terminal).
    Sequence:

    GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR


    Database link: NP_002997

  • Positive control

    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab134243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • Function

    A SLe(x)-type proteoglycan, which through high affinity, calcium-dependent interactions with E-, P- and L-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation. Critical for the initial leukocyte capture.
    (Microbial infection) Acts as a receptor for enterovirus 71.
  • Tissue specificity

    Expressed on neutrophils, monocytes and most lymphocytes.
  • Post-translational
    modifications

    Displays complex, core-2, sialylated and fucosylated O-linked oligosaccharides, at least some of which appear to contain poly-N-acetyllactosamine with varying degrees of substitution. Mainly disialylated or neutral forms of the core-2 tetrasaccharide, Galbeta1-->4GlcNAcbeta1-->6(Galbeta1-->3)GalNAcOH. The GlcN:GalN ratio is approximately 2:1 and the Man:Fuc ratio 3:5. Contains about 14% fucose with alpha-1,3 linkage present in two forms: One species is a disialylated, monofucosylated glycan, and the other, a monosialylated, trifucosylated glycan with a polylactosamine backbone. The fucosylated forms carry the Lewis antigen and are important for interaction with selectins and for functioning in leukocyte rolling. The modification containing the sialyl Lewis X glycan is on Thr-57. No sulfated O-glycans. Some N-glycosylation.
    Sulfation, in conjunction with the SLe(x)-containing glycan, is necessary for P- and L-selectin binding. High affinity P-selectin binding has a preferred requirement for the isomer sulfated on both Tyr-48 and Tyr-51, whereas L-selectin binding requires predominantly sulfation on Tyr-51 with sulfation on Tyr-48 playing only a minor role. These sulfations play an important role in L- and P-selectin-mediated neutrophil recruitment, and leukocyte rolling.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 162 antibody
    • CD162 antibody
    • CD162 antigen antibody
    • CLA antibody
    • Cutaneous lymphocyte associated associated antigen antibody
    • P selectin glycoprotein ligand 1 antibody
    • P selectin glycoprotein ligand 1 precursor antibody
    • P-selectin glycoprotein ligand 1 antibody
    • PSGL 1 antibody
    • PSGL-1 antibody
    • PSGL1 antibody
    • Selectin P ligand antibody
    • SELPL_HUMAN antibody
    • SELPLG antibody
    see all

Images

  • Anti-PSGL-1 antibody (ab134243) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Predicted band size: 43 kDa

References

ab134243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up