Anti-PSIP1/LEDGF antibody (ab244372)
Key features and details
- Rabbit polyclonal to PSIP1/LEDGF
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PSIP1/LEDGF antibody
See all PSIP1/LEDGF primary antibodies -
Description
Rabbit polyclonal to PSIP1/LEDGF -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow, Cat -
Immunogen
Recombinant fragment corresponding to Human PSIP1/LEDGF aa 155-238.
Sequence:KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPC PSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ
Database link: O75475 -
Positive control
- ICC/IF: U-2 OS cells. IHC-P: Human cerebral cortex tissue.
-
General notes
This product was previously labelled as PSIP1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration. -
Tissue specificity
Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventricular zone (SVZ), in hippocampus, and undetectable elsewhere. In the fetal brain, expressed in the germinal neuroepithelium and cortical plate regions. -
Involvement in disease
Note=A chromosomal aberration involving PSIP1 is associated with pediatric acute myeloid leukemia (AML) with intermediate characteristics between M2-M3 French-American-British (FAB) subtypes. Translocation t(9;11)(p22;p15) with NUP98. The chimeric transcript is an in-frame fusion of NUP98 exon 8 to PSIP1/LEDGF exon 4. -
Sequence similarities
Belongs to the HDGF family.
Contains 1 PWWP domain. -
Domain
Residues 340-417 are necessary and sufficient for the interaction with HIV-1 IN (IBD domain). -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. Remains chromatin-associated throughout the cell cycle. - Information by UniProt
-
Database links
- Entrez Gene: 282011 Cow
- Entrez Gene: 11168 Human
- Omim: 603620 Human
- SwissProt: Q66T72 Cat
- SwissProt: O75475 Human
- Unigene: 726445 Human
-
Alternative names
- CLL associated antigen KW 7 antibody
- CLL-associated antigen KW-7 antibody
- Dense fine speckles 70 kDa protein antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PSIP1/LEDGF (green) using ab244372 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSIP1/LEDGF antibody (ab244372)
Paraffin-embedded human cerebral cortex tissue stained for PSIP1/LEDGF using ab244372 at 1/500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSIP1/LEDGF antibody (ab244372)
Paraffin-embedded human liver tissue stained for PSIP1/LEDGF using ab244372 at 1/500 dilution in immunohistochemical analysis.
Low expression as expected.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244372 has not yet been referenced specifically in any publications.