Anti-PSIP1/LEDGF antibody (ab244372)

Submit a review Submit a question

Overview

  • Product name

    Anti-PSIP1/LEDGF antibody
    See all PSIP1/LEDGF primary antibodies

  • Description

    Rabbit polyclonal to PSIP1/LEDGF

  • Host species

    Rabbit

  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Cat

  • Immunogen

    Recombinant fragment corresponding to Human PSIP1/LEDGF aa 155-238.
    Sequence:

    KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPC PSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ


    Database link: O75475

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • ICC/IF: U-2 OS cells. IHC-P: Human cerebral cortex tissue.

  • General notes

     This product was previously labelled as PSIP1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab244372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration.

  • Tissue specificity

    Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventricular zone (SVZ), in hippocampus, and undetectable elsewhere. In the fetal brain, expressed in the germinal neuroepithelium and cortical plate regions.

  • Involvement in disease

    Note=A chromosomal aberration involving PSIP1 is associated with pediatric acute myeloid leukemia (AML) with intermediate characteristics between M2-M3 French-American-British (FAB) subtypes. Translocation t(9;11)(p22;p15) with NUP98. The chimeric transcript is an in-frame fusion of NUP98 exon 8 to PSIP1/LEDGF exon 4.

  • Sequence similarities

    Belongs to the HDGF family.
    Contains 1 PWWP domain.

  • Domain

    Residues 340-417 are necessary and sufficient for the interaction with HIV-1 IN (IBD domain).

  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.

  • Cellular localization

    Nucleus. Remains chromatin-associated throughout the cell cycle.
  • Information by UniProt

  • Database links

    • Alternative names

      • CLL associated antigen KW 7 antibody
      • CLL-associated antigen KW-7 antibody
      • Dense fine speckles 70 kDa protein antibody
      • DFS 70 antibody
      • DFS70 antibody
      • LEDGF antibody
      • Lens epithelium derived growth factor antibody
      • Lens epithelium-derived growth factor antibody
      • MGC74712 antibody
      • p52 antibody
      • p75 antibody
      • PAIP antibody
      • PC4 and SFRS1 interacting protein 1 antibody
      • PC4 and SFRS1 interacting protein 2 antibody
      • PC4 and SFRS1 interacting protein antibody
      • PC4 and SFRS1-interacting protein antibody
      • PSIP 1 antibody
      • PSIP 2 antibody
      • Psip1 antibody
      • PSIP1_HUMAN antibody
      • PSIP2 antibody
      • Transcriptional coactivator p75/p52 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-PSIP1/LEDGF antibody (ab244372)
      Immunocytochemistry/ Immunofluorescence - Anti-PSIP1/LEDGF antibody (ab244372)

      PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PSIP1/LEDGF (green) using ab244372 at 4 µg/ml in ICC/IF.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSIP1/LEDGF antibody (ab244372)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSIP1/LEDGF antibody (ab244372)

      Paraffin-embedded human cerebral cortex tissue stained for PSIP1/LEDGF using ab244372 at 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSIP1/LEDGF antibody (ab244372)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSIP1/LEDGF antibody (ab244372)

      Paraffin-embedded human liver tissue stained for PSIP1/LEDGF using ab244372 at 1/500 dilution in immunohistochemical analysis.

      Low expression as expected.

    References

    ab244372 has not yet been referenced specifically in any publications.

    Publishing research using ab244372? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab244372.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com