Overview

  • Product name

  • Description

    Rabbit polyclonal to PSIP1/LEDGF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human PSIP1/LEDGF aa 324-373 (internal sequence).
    Sequence:

    TEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRC

  • Positive control

    • Jurkat whole cell lysate (ab7899)
  • General notes

     This product was previously labelled as PSIP1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab49281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 5 µg/ml. Detects a band of approximately 68 kDa (predicted molecular weight: 60 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:62500.

Target

  • Function

    Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration.
  • Tissue specificity

    Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventricular zone (SVZ), in hippocampus, and undetectable elsewhere. In the fetal brain, expressed in the germinal neuroepithelium and cortical plate regions.
  • Involvement in disease

    Note=A chromosomal aberration involving PSIP1 is associated with pediatric acute myeloid leukemia (AML) with intermediate characteristics between M2-M3 French-American-British (FAB) subtypes. Translocation t(9;11)(p22;p15) with NUP98. The chimeric transcript is an in-frame fusion of NUP98 exon 8 to PSIP1/LEDGF exon 4.
  • Sequence similarities

    Belongs to the HDGF family.
    Contains 1 PWWP domain.
  • Domain

    Residues 340-417 are necessary and sufficient for the interaction with HIV-1 IN (IBD domain).
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Remains chromatin-associated throughout the cell cycle.
  • Information by UniProt
  • Database links

  • Alternative names

    • CLL associated antigen KW 7 antibody
    • CLL-associated antigen KW-7 antibody
    • Dense fine speckles 70 kDa protein antibody
    • DFS 70 antibody
    • DFS70 antibody
    • LEDGF antibody
    • Lens epithelium derived growth factor antibody
    • Lens epithelium-derived growth factor antibody
    • MGC74712 antibody
    • p52 antibody
    • p75 antibody
    • PAIP antibody
    • PC4 and SFRS1 interacting protein 1 antibody
    • PC4 and SFRS1 interacting protein 2 antibody
    • PC4 and SFRS1 interacting protein antibody
    • PC4 and SFRS1-interacting protein antibody
    • PSIP 1 antibody
    • PSIP 2 antibody
    • Psip1 antibody
    • PSIP1_HUMAN antibody
    • PSIP2 antibody
    • Transcriptional coactivator p75/p52 antibody
    see all

Images

  • Western blot analysis of Jurkat cell lysate labeling PSIP1/LEDGF with ab49281 at 1µg/ml.

  • Western blot analysis of Jurkat cell lysate labeling PSIP1/LEDGF with ab49281 at 1µg/ml.

  • Anti-PSIP1/LEDGF antibody (ab49281) at 5 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 60 kDa
    Observed band size: 68 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

Question
Answer

Thank you very much for your interest in ab49281. To our knowledge, ab49281 has not been tested using a Biacore. It is not possible to submit Abreviews for this application but we would be interested in your experience with IP. Therefore, I can offer a discount off a future purchase if you buy ab49281 now, test it in IP and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody. If you are interested in this offer, please follow these steps: 1. Reply to this e-mail to let me know that you would like to proceed and test ab49281 in IP. I will then send a discount code. This code must be issued before purchasing ab49281 so please wait for my reply before ordering. 2. Purchase ab49281 either by phone, fax, or online (www.abcam.com). 3. Test it in IP and Biacore. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out more about our Abreview system, please visit: https://www.abcam.com/abreviews. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue. We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab49281 turns out to be unsuitable for IP or Biacore, you will still receive the discount on your next purchase after your Abreview has been submitted. Please let me know if you have any questions about this offer and I would be happy to help you further. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up