Overview

  • Product name

  • Description

    Rabbit polyclonal to PSMA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Pig PSMA aa 275-588. (Expressed in E.coli).
    Sequence:

    ANEYAYRLQIAEAVGLPRIPVHPIGYSDAQKLLEKMGGSAPPDDSWKGSL HVPYNVGPGFTGNFSTQKVKMHIHSDNKVKRIYNVIGTLRGAVEPDRYVI LGGHRDSWVFGGIDPQSGAAVVHEIVRSFGKLKKEGWRPRRTVLFASWDA EEYGLFGSTEWAEENSRILQERGVAYINADSSIEGNYTLRVDCTPLMYSL VYNLTKELQSPDEGFEGKSLFESWNEKSPSPEFSGLPRISKLGSGNDFEV FFQRLGIASGRARYTKDWVTNKFSSYPLYHSVYETYELVEKFYDPTFKYH LAVAQVRGGIVFEL


    Database link: O77564

  • Positive control

    • IHC-P: Pig kidney tissue. WB: Pig kidney and small intestine lysates; Recombinant pig PSMA protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 85 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Isoform PSM-4 and isoform PSM-5 would appear to be physiologically irrelevant. Involved in prostate tumor progression.
    Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.
  • Tissue specificity

    Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kidney, liver, spleen, colon, trachea, spinal cord and the capillary endothelium of a variety of tumors. Expressed specifically in jejunum brush border membranes. In the brain, highly expressed in the ventral striatum and brain stem. Also expressed in fetal liver and kidney. Isoform PSMA' is the most abundant form in normal prostate. Isoform PSMA-1 is the most abundant form in primary prostate tumors. Isoform PSMA-2 is also found in normal prostate as well as in brain and liver. Isoform PSMA-9 is specifically expressed in prostate cancer.
  • Sequence similarities

    Belongs to the peptidase M28 family. M28B subfamily.
  • Domain

    The NAALADase activity is found in the central region, the dipeptidyl peptidase IV type activity in the C-terminal.
  • Post-translational
    modifications

    The first two amino acids at the N-terminus of isoform PSMA' appear to be cleaved by limited proteolysis.
    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell growth inhibiting protein 27 antibody
    • Cell growth-inhibiting gene 27 protein antibody
    • FGCP antibody
    • Folate hydrolase (prostate-specific membrane antigen) 1 antibody
    • Folate hydrolase 1 antibody
    • Folate hydrolase antibody
    • Folate hydrolase prostate specific membrane antigen 1 antibody
    • FOLH 1 antibody
    • FOLH antibody
    • Folh1 antibody
    • FOLH1_HUMAN antibody
    • Folylpoly gamma glutamate carboxypeptidase antibody
    • Folylpoly-gamma-glutamate carboxypeptidase antibody
    • GCP 2 antibody
    • GCP II antibody
    • GCP2 antibody
    • GCPII antibody
    • GIG27 antibody
    • Glutamate carboxylase II antibody
    • Glutamate carboxypeptidase 2 antibody
    • Glutamate carboxypeptidase II antibody
    • Membrane glutamate carboxypeptidase antibody
    • mGCP antibody
    • N acetylated alpha linked acidic dipeptidase 1 antibody
    • N-acetylated-alpha-linked acidic dipeptidase I antibody
    • NAALAD 1 antibody
    • NAALAD1 antibody
    • NAALAdase antibody
    • NAALADase I antibody
    • Prostate specific membrane antigen antibody
    • Prostate specific membrane antigen variant F antibody
    • Prostate-specific membrane antigen antibody
    • PSM antibody
    • PSMA antibody
    • Pteroylpoly gamma glutamate carboxypeptidase antibody
    • Pteroylpoly-gamma-glutamate carboxypeptidase antibody
    see all

Images

  • Paraffin-embedded pig kidney tissue stained for PSMA using ab231319 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PSMA antibody (ab231319) at 2 µg/ml + Recombinant pig PSMA protein

    Predicted band size: 85 kDa

  • Anti-PSMA antibody (ab231319) at 2 µg/ml + Pig kidney lysate

    Predicted band size: 85 kDa

  • Anti-PSMA antibody (ab231319) at 2 µg/ml + Pig small intestine lysate

    Predicted band size: 85 kDa

References

ab231319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up