For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    psma3-antibody-ab180784.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Proteasome
Share by email

Anti-PSMA3 antibody (ab180784)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-PSMA3 antibody (ab180784)
  • Immunoprecipitation - Anti-PSMA3 antibody (ab180784)
  • Western blot - Anti-PSMA3 antibody (ab180784)
  • Immunocytochemistry/ Immunofluorescence - Anti-PSMA3 antibody (ab180784)

Key features and details

  • Rabbit polyclonal to PSMA3
  • Suitable for: WB, ICC/IF, IP
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human PSMA3 protein (ab115712)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-PSMA3 antibody
    See all PSMA3 primary antibodies
  • Description

    Rabbit polyclonal to PSMA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PSMA3 aa 1-255.
    Sequence:

    MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGV EKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFR SNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLY MIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYI VHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDES DDDNM


    Database link: P25788
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • JAR, A549 and PC12 cell extracts.
  • General notes

     This product was previously labelled as Proteasome 20S alpha 3

     

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Proteasome

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human PSMA3 protein (ab115712)
  • Related Products

    • Recombinant Human PSMA3 protein (ab115712)
    • PC-12 cytoplasmic extract lysate (ab14883)
    • A549 whole cell lysate (ab7910)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab180784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
1/500 - 1/2000. Predicted molecular weight: 28 kDa.
ICC/IF
1/50 - 1/200.
IP
1/1000.
Notes
WB
1/500 - 1/2000. Predicted molecular weight: 28 kDa.
ICC/IF
1/50 - 1/200.
IP
1/1000.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.
  • Sequence similarities

    Belongs to the peptidase T1A family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Target information above from: UniProt accession P25788 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 5684 Human
    • Entrez Gene: 19167 Mouse
    • Entrez Gene: 29670 Rat
    • Entrez Gene: 408248 Rat
    • Omim: 176843 Human
    • SwissProt: P25788 Human
    • SwissProt: O70435 Mouse
    • SwissProt: P18422 Rat
    • Unigene: 558799 Human
    • Unigene: 296338 Mouse
    • Unigene: 3997 Rat
    see all
  • Alternative names

    • HC8 antibody
    • Macropain subunit C8 antibody
    • MGC12306 antibody
    • MGC32631 antibody
    • Multicatalytic endopeptidase complex subunit C8 antibody
    • Proteasome (prosome macropain) subunit alpha type 3 antibody
    • Proteasome alpha 3 subunit antibody
    • Proteasome component C8 antibody
    • Proteasome subunit alpha type 3 antibody
    • Proteasome subunit alpha type-3 antibody
    • Proteasome subunit C8 antibody
    • PSA3_HUMAN antibody
    • PSC8 antibody
    • psmA3 antibody
    see all

Images

  • Western blot - Anti-PSMA3 antibody (ab180784)
    Western blot - Anti-PSMA3 antibody (ab180784)
    All lanes : Anti-PSMA3 antibody (ab180784) at 1/1000 dilution

    Lane 1 : MCF7 cell lysate with 3% nonfat dry milk in TBST
    Lane 2 : DU145 cell lysate with 3% nonfat dry milk in TBST
    Lane 3 : HL-60 cell lysate with 3% nonfat dry milk in TBST
    Lane 4 : PC-3 cell lysate with 3% nonfat dry milk in TBST
    Lane 5 : Mouse liver lysate with 3% nonfat dry milk in TBST
    Lane 6 : Mouse spleen lysate with 3% nonfat dry milk in TBST

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Predicted band size: 28 kDa

  • Immunoprecipitation - Anti-PSMA3 antibody (ab180784)
    Immunoprecipitation - Anti-PSMA3 antibody (ab180784)

    Immunoprecipitation analysis of 200 μg extracts of HL-60 cells, using 3 μg of ab180784. Western blot was performed from the immunoprecipitate using ab180784 at a dilition of 1:1000.

  • Western blot - Anti-PSMA3 antibody (ab180784)
    Western blot - Anti-PSMA3 antibody (ab180784)
    All lanes : Anti-PSMA3 antibody (ab180784) at 1/500 dilution

    Lane 1 : JAR cell extracts
    Lane 2 : A549 cell extracts
    Lane 3 : PC12 cell extracts

    Predicted band size: 28 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-PSMA3 antibody (ab180784)
    Immunocytochemistry/ Immunofluorescence - Anti-PSMA3 antibody (ab180784)
    Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180784. Blue DAPI for nuclear staining.

Protocols

  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab180784? Please let us know so that we can cite the reference in this datasheet.

ab180784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab180784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.