Anti-PSMA3 antibody (ab180784)
Key features and details
- Rabbit polyclonal to PSMA3
- Suitable for: WB, ICC/IF, IP
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-PSMA3 antibody
See all PSMA3 primary antibodies -
Description
Rabbit polyclonal to PSMA3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IPmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant full length protein corresponding to Human PSMA3 aa 1-255.
Sequence:MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGV EKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFR SNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLY MIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYI VHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDES DDDNM
Database link: P25788 -
Positive control
- JAR, A549 and PC12 cell extracts.
-
General notes
This product was previously labelled as Proteasome 20S alpha 3
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180784 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 28 kDa.
|
|
ICC/IF |
1/50 - 1/200.
|
|
IP |
1/1000.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 28 kDa. |
ICC/IF
1/50 - 1/200. |
IP
1/1000. |
Target
-
Function
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2. -
Sequence similarities
Belongs to the peptidase T1A family. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 5684 Human
- Entrez Gene: 19167 Mouse
- Entrez Gene: 29670 Rat
- Entrez Gene: 408248 Rat
- Omim: 176843 Human
- SwissProt: P25788 Human
- SwissProt: O70435 Mouse
- SwissProt: P18422 Rat
see all -
Alternative names
- HC8 antibody
- Macropain subunit C8 antibody
- MGC12306 antibody
see all
Images
-
All lanes : Anti-PSMA3 antibody (ab180784) at 1/1000 dilution
Lane 1 : MCF7 cell lysate with 3% nonfat dry milk in TBST
Lane 2 : DU145 cell lysate with 3% nonfat dry milk in TBST
Lane 3 : HL-60 cell lysate with 3% nonfat dry milk in TBST
Lane 4 : PC-3 cell lysate with 3% nonfat dry milk in TBST
Lane 5 : Mouse liver lysate with 3% nonfat dry milk in TBST
Lane 6 : Mouse spleen lysate with 3% nonfat dry milk in TBST
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution
Predicted band size: 28 kDa -
Immunoprecipitation analysis of 200 μg extracts of HL-60 cells, using 3 μg of ab180784. Western blot was performed from the immunoprecipitate using ab180784 at a dilition of 1:1000.
-
All lanes : Anti-PSMA3 antibody (ab180784) at 1/500 dilution
Lane 1 : JAR cell extracts
Lane 2 : A549 cell extracts
Lane 3 : PC12 cell extracts
Predicted band size: 28 kDa -
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180784. Blue DAPI for nuclear staining.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab180784 has not yet been referenced specifically in any publications.