Overview

  • Product name

    Anti-PSMB10/MECL1 antibody
    See all PSMB10/MECL1 primary antibodies
  • Description

    Rabbit polyclonal to PSMB10/MECL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PSMB10/MECL1 aa 127-199.
    Sequence:

    FRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAV LEDRFQPNMTLEAAQGLLVEAVT


    Database link: P40306

  • Positive control

    • Human tonsil tissue; A549 cells.
  • General notes

     This product was previously labelled as PSMB10

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
  • Sequence similarities

    Belongs to the peptidase T1B family.
  • Developmental stage

    Highly expressed in immature dendritic cells (at protein level).
  • Post-translational
    modifications

    Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • beta2i antibody
    • FLJ00366 antibody
    • LMP10 antibody
    • Low molecular mass protein 10 antibody
    • Macropain subunit MECl 1 antibody
    • Macropain subunit MECl-1 antibody
    • MECL1 antibody
    • MGC1665 antibody
    • Multicatalytic endopeptidase complex subunit MECl 1 antibody
    • Multicatalytic endopeptidase complex subunit MECl-1 antibody
    • OTTHUMP00000174858 antibody
    • Proteasome (prosome macropain) subunit beta type 10 antibody
    • Proteasome beta 10 subunit antibody
    • Proteasome catalytic subunit 2i antibody
    • Proteasome MECl 1 antibody
    • Proteasome MECl-1 antibody
    • Proteasome subunit beta 2i antibody
    • Proteasome subunit beta 7i antibody
    • Proteasome subunit beta type 10 antibody
    • Proteasome subunit beta type-10 antibody
    • Proteasome subunit beta-2i antibody
    • Proteasome subunit MECL1 antibody
    • PSB10_HUMAN antibody
    • PSMB 10 antibody
    • Psmb10 antibody
    see all

Images

  • Immunofluorescent analysis of A549 cells labeling PSMB10/MECL1 with ab204839 at 4 µg/ml (green).

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human tonsil tissue labeling PSMB10/MECL1 with ab204839 at 1/50.

References

ab204839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up