Overview

  • Product name

    Anti-PSMB11 antibody - C-terminal
  • Description

    Rabbit polyclonal to PSMB11 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human PSMB11 aa 227-276 (C terminal).
    Sequence:

    HVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAED


    Database link: A5LHX3

  • Positive control

    • OVCAR-3 whole cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa.

Target

  • Function

    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Incorporated instead of PSMB5 or PSMB8, this unit reduces the chymotrypsin-like activity of the proteasome (By similarity). Plays a pivotal role in development of CD8-positive T cells.
  • Sequence similarities

    Belongs to the peptidase T1B family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BETA5T antibody
    • Proteasome (prosome, macropain) subunit beta type 11 antibody
    • Proteasome subunit beta 5T antibody
    • Proteasome subunit beta type-11 antibody
    • Proteasome subunit beta-5t antibody
    • PSB11_HUMAN antibody
    • PSMB11 antibody
    see all

Images

  • Anti-PSMB11 antibody - C-terminal (ab140279) at 1 µg/ml + OVCAR-3 whole cell lysate at 10 µg

    Predicted band size: 33 kDa

References

ab140279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up