Anti-PSMB5/MB1 antibody (ab167341)
Key features and details
- Mouse polyclonal to PSMB5/MB1
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PSMB5/MB1 antibody
See all PSMB5/MB1 primary antibodies -
Description
Mouse polyclonal to PSMB5/MB1 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human PSMB5/MB1 aa 1-263.
Sequence:MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPE EPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYL LGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDR GYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDN VADLHEKYSGSTP
Database link: P28074 -
Positive control
- PSMB5/MB1 transfected 293T cell line lysate. HeLa cells.
-
General notes
Previously labelled as PSMB5.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab167341 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa. | |
ICC/IF | Use a concentration of 10 µg/ml. |
Target
-
Function
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the chymotrypsin-like activity of the proteasome and is one of the principal target of the proteasome inhibitor bortezomib. May catalyze basal processing of intracellular antigens. Plays a role in the protection against oxidative damage throught the Nrf2-ARE pathway. -
Sequence similarities
Belongs to the peptidase T1B family. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 5693 Human
- Omim: 600306 Human
- SwissProt: P28074 Human
- Unigene: 422990 Human
-
Alternative names
- DKFZp459C139 antibody
- EC 3.4.25.1 antibody
- LMPX antibody
see all
Images
-
All lanes : Anti-PSMB5/MB1 antibody (ab167341) at 1 µg/ml
Lane 1 : PSMB5/MB1 transfected 293T cell line lysate
Lane 2 : Non-transfected 293T cell line lysate
Lysates/proteins at 15 µl per lane.
Predicted band size: 28 kDa -
Immunofluorescent analysis of HeLa cells labeling PSMB5/MB1 with ab167341 at 10 µg/ml.
Protocols
Datasheets and documents
References (0)
ab167341 has not yet been referenced specifically in any publications.