Overview

  • Product name

    Anti-PSMD11 antibody (HRP)
    See all PSMD11 primary antibodies
  • Description

    Rabbit polyclonal to PSMD11 (HRP)
  • Host species

    Rabbit
  • Conjugation

    HRP
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Dog, Human, Zebrafish
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human PSMD11 aa 2-422.
    Sequence:

    AAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSIL ELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEA ATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGS QLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIY CPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSL KYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLAD FEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHIS SLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAAL ETIQNMSKVVDSLYNKAKKLT


    Database link: O00231

  • Positive control

    • EC109 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/20 - 1/300. Predicted molecular weight: 47 kDa.

Target

  • Function

    Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. In the complex, PSMD11 is required for proteasome assembly. Plays a key role in increased proteasome activity in embryonic stem cells (ESCs): its high expression in ESCs promotes enhanced assembly of the 26S proteasome, followed by higher proteasome activity.
  • Tissue specificity

    Highly expressed in embryonic stem cells (ESCs). Expression decreases as ESCs differentiate.
  • Sequence similarities

    Belongs to the proteasome subunit S9 family.
    Contains 1 PCI domain.
  • Post-translational
    modifications

    Phosphorylated by AMPK.
  • Cellular localization

    Nucleus. Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • 26S proteasome non-ATPase regulatory subunit 11 antibody
    • 26S proteasome regulatory subunit 9 antibody
    • 26S proteasome regulatory subunit p44.5 antibody
    • 26S proteasome regulatory subunit RPN6 antibody
    • 26S proteasome regulatory subunit S9 antibody
    • MGC3844 antibody
    • p44.5 antibody
    • protease 26S, subunit, 9 antibody
    • proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 antibody
    • proteasome 26S subunit, non-ATPase, 11 antibody
    • PSD11_HUMAN antibody
    • PSMD 11 antibody
    • PSMD11 antibody
    • Rpn6 antibody
    • S9 antibody
    see all

Images

  • Anti-PSMD11 antibody (HRP) (ab193139) at 2 µg/ml + EC109 whole cell lysate at 20 µg

    Secondary
    Goat polyclonal to Rabbit IgG at 1/15000 dilution

    Predicted band size: 47 kDa
    Observed band size: 47 kDa

References

ab193139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up