Overview

  • Product name

  • Description

    Rabbit polyclonal to PSMD12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PSMD12 aa 263-361.
    Sequence:

    WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTM ELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEH


    Database link: O00232

  • Positive control

    • IHC-P: Human testis tissue. WB: RT4 and U-251 MG cell lysate; Human liver tissue lysate. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as 26S proteasome non-ATPase regulatory subunit 12

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab246940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities

    Belongs to the proteasome subunit p55 family.
    Contains 1 PCI domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 26S proteasome non-ATPase regulatory subunit 12 antibody
    • 26S proteasome regulatory subunit p55 antibody
    • 26S proteasome regulatory subunit RPN5 antibody
    • MGC75406 antibody
    • p55 antibody
    • proteasome (prosome, macropain) 26S subunit, non ATPase12 antibody
    • Proteasome 26S non ATPase subunit 12 isoform 2 antibody
    • PSD12_HUMAN antibody
    • PSMD12 antibody
    • Rpn5 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells  labeling PSMD12 using ab246940 at 4 µg/ml (green) in ICC/IF.

  • Paraffin-embedded human testis tissue stained for PSMD12 ab246940 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human salivary gland tissue stained for PSMD12 using ab246940 at 1/200 dilution in immunohistochemical analysis. Low expression as expected.

  • All lanes : Anti-PSMD12 antibody (ab246940) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

References

ab246940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up