Overview

  • Product name

  • Description

    Rabbit polyclonal to PSMD6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human PSMD6 aa 1-389. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNM APYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEI RDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLF YMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAEL FLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVL HSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKV NEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM


    Database link: Q15008

  • Positive control

    • IHC-P: Human kidney tissue. WB: Jurkat and HEK-293T cell lysates; Pig liver and cerebrum lysates; Recombinant human PSMD6 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233277 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 46 kDa.

Target

  • Function

    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities

    Belongs to the proteasome subunit S10 family.
    Contains 1 PCI domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 26S proteasome non-ATPase regulatory subunit 6 antibody
    • 26S proteasome regulatory subunit RPN7 antibody
    • 26S proteasome regulatory subunit S10 antibody
    • Breast cancer-associated protein SGA-113M antibody
    • KIAA0107 antibody
    • p42A antibody
    • P44S10 antibody
    • PFAAP4 antibody
    • Phosphonoformate immuno-associated protein 4 antibody
    • Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 antibody
    • Proteasome regulatory particle subunit p44S10 antibody
    • PSMD6 antibody
    • PSMD6_HUMAN antibody
    • Rpn7 antibody
    • S10 antibody
    • SGA-113M antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PSMD^using ab233277 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PSMD6 antibody (ab233277) at 2 µg/ml + Recombinant human PSMD6 protein

    Predicted band size: 46 kDa

  • Anti-PSMD6 antibody (ab233277) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Predicted band size: 46 kDa

  • Anti-PSMD6 antibody (ab233277) at 2 µg/ml + Pig liver tissue lysate

    Predicted band size: 46 kDa

  • Anti-PSMD6 antibody (ab233277) at 2 µg/ml + Pig cerebrum tissue lysate

    Predicted band size: 46 kDa

  • Anti-PSMD6 antibody (ab233277) at 2 µg/ml + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 46 kDa

References

ab233277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up