Overview

  • Product name

  • Description

    Rabbit polyclonal to PSMD7/Mov34
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Xenopus laevis, Chimpanzee, Drosophila melanogaster, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide corresponding to Human PSMD7/Mov34 aa 150-200.
    Sequence:

    PTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLK G


    Database link: NP_002802.2

  • Positive control

    • 293T, HeLa, Jurkat and NIH 3T3 whole cell lysates.
  • General notes

     This product was previously labelled as PSMD7

Properties

Applications

Our Abpromise guarantee covers the use of ab140428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 37 kDa.
IP Use at 2-10 µg/mg of lysate.
IHC-P 1/1000.

Target

  • Function

    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities

    Belongs to the peptidase M67A family.
    Contains 1 MPN (JAB/Mov34) domain.
  • Information by UniProt
  • Database links

    see all
  • Alternative names

    • 26S proteasome non ATPase regulatory subunit 7 antibody
    • 26S proteasome non-ATPase regulatory subunit 7 antibody
    • 26S proteasome regulatory subunit RPN8 antibody
    • 26S proteasome regulatory subunit S12 antibody
    • integration site gene, mouse, homolog of antibody
    • Moloney leukemia virus 34 proviral antibody
    • Moloney leukemia virus 34 proviral integration antibody
    • MOV34 antibody
    • Mov34 homolog antibody
    • Mov34 protein homolog antibody
    • MOV34L antibody
    • P40 antibody
    • Proteasome (prosome, macropain) 26S subunit, non ATPase 7 antibody
    • Proteasome (prosome, macropain) 26S subunit, non ATPase, 7 (Mov34 homolog) antibody
    • Proteasome 26S S12 antibody
    • Proteasome 26S subunit, no-ATPase, 7 antibody
    • Proteasome subunit p40 antibody
    • PSD7_HUMAN antibody
    • PSMD 7 antibody
    • PSMD7 antibody
    • Rpn8 antibody
    • S12 antibody
    see all

Images

  • Immunohistochemistry of human ovarian carcinoma using ab140428 at 1/1000. Detected using DAB. 

  • Immunohistochemistry of human lung carcinoma using ab140428 at 1/1000. Counterstained with hematoxylin, detected using DAB. 

  • All lanes : Anti-PSMD7/Mov34 antibody (ab140428) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg
    Lane 5 : NIH 3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 37 kDa


    Exposure time: 3 minutes
  • Detection of PSMD7/Mov34 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab140428 at 6 µg/mg lysate for IP and 1µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab140428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up