Overview

  • Product name

  • Description

    Rabbit polyclonal to PSME1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human PSME1 aa 1-249.
    Sequence:

    MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALN EANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPP CGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGV AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQL VHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY


    Database link: Q06323

  • Positive control

    • MCF7, ZZRV-1, and BT474 cell extracts; Mouse spleen, liver, lung, thymus and heart extracts.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 29 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
  • Sequence similarities

    Belongs to the PA28 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 11S regulator complex alpha subunit antibody
    • 11S regulator complex subunit alpha antibody
    • 29 kD MCP activator subunit antibody
    • 29kD MCP activator subunit antibody
    • Activator of multicatalytic protease subunit 1 antibody
    • IFI5111 antibody
    • IGUP I-5111 antibody
    • Interferon gamma IEF SSP 5111 antibody
    • Interferon gamma inducible protein 5111 antibody
    • Interferon gamma up regulated I 5111 protein antibody
    • Interferon gamma up-regulated I-5111 protein antibody
    • MGC8628 antibody
    • PA28a antibody
    • PA28alpha antibody
    • Proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) antibody
    • Proteasome activator 28 subunit alpha antibody
    • Proteasome activator complex subunit 1 antibody
    • Proteasome activator subunit 1 antibody
    • PSME1 antibody
    • PSME1_HUMAN antibody
    • REG-alpha antibody
    • REGalpha antibody
    see all

Images

  • All lanes : Anti-PSME1 antibody (ab186832) at 1/500 dilution

    Lane 1 : MCF7 cell extract
    Lane 2 : ZZRV-1 cell extract
    Lane 3 : BT474 cell extract
    Lane 4 : Mouse spleen extract
    Lane 5 : Mouse liver extract
    Lane 6 : Mouse lung extract
    Lane 7 : Mouse heart extract
    Lane 8 : Mouse thymus extract

    Predicted band size: 29 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling PSME1 with ab186832 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling PSME1 with ab186832 at 1/200. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophagus tissue labelling PSME1 with ab186832 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophagus tissue labelling PSME1 with ab186832 at 1/200. Magnification: 200x.
  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab186832. Blue DAPI for nuclear staining.

References

ab186832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up