Overview

  • Product name

  • Description

    Rabbit polyclonal to PSME1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human PSME1 aa 1-249.
    Sequence:

    MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALN EANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPP CGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGV AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQL VHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY


    Database link: Q06323-1

  • Positive control

    • WB: Mouse liver tissue lysate. Raji whole cell lysate. IHC-P: Human liver cancer and testis tissues. IP: Jurkat whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 29 kDa.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
  • Sequence similarities

    Belongs to the PA28 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 11S regulator complex alpha subunit antibody
    • 11S regulator complex subunit alpha antibody
    • 29 kD MCP activator subunit antibody
    • 29kD MCP activator subunit antibody
    • Activator of multicatalytic protease subunit 1 antibody
    • IFI5111 antibody
    • IGUP I-5111 antibody
    • Interferon gamma IEF SSP 5111 antibody
    • Interferon gamma inducible protein 5111 antibody
    • Interferon gamma up regulated I 5111 protein antibody
    • Interferon gamma up-regulated I-5111 protein antibody
    • MGC8628 antibody
    • PA28a antibody
    • PA28alpha antibody
    • Proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) antibody
    • Proteasome activator 28 subunit alpha antibody
    • Proteasome activator complex subunit 1 antibody
    • Proteasome activator subunit 1 antibody
    • PSME1 antibody
    • PSME1_HUMAN antibody
    • REG-alpha antibody
    • REGalpha antibody
    see all

Images

  • All lanes : Anti-PSME1 antibody (ab236877) at 1/500 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Raji (human Burkitt's lymphoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 29 kDa

  • Paraffin-embedded human testis tissue stained for PSME1 using ab236877 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for PSME1 using ab236877 at 1/100 dilution in immunohistochemical analysis.

  • PSME1 was immunoprecipitated from Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate using ab236877 at 1/200 dilution.

    Lane 1: Rabbit control IgG in Jurkat whole cell lysate.

    Lane 2: ab236877 in Jurkat whole cell lysate.

    Lane 3: Jurkat whole cell lysate (10 µg input).

    For western blotting an HRP-conjugated Protein G antibody was used as the secondary antibody at a 1/2000 dilution.

References

ab236877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up