Overview

  • Product name

  • Description

    Rabbit polyclonal to PSME3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human PSME3 aa 1-254.
    Sequence:

    MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPIL NIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTK VFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDG NNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVE DYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNA ETLY


    Database link: P61289

  • Positive control

    • MCF7 and PC12 cell lysates; Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab180829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 29 kDa.

Target

  • Function

    Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a donut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation.
  • Sequence similarities

    Belongs to the PA28 family.
  • Domain

    The C-terminal sequences affect heptamer stability and proteasome affinity.
  • Post-translational
    modifications

    Phosphorylated by MAP3K3.
  • Cellular localization

    Nucleus. Cytoplasm. Localizes to the cytoplasm during mitosis following nuclear envelope breakdown at this distinct stage of the cell cycle which allows its interaction with MAP3K3 kinase.
  • Information by UniProt
  • Database links

  • Alternative names

    • 11S regulator complex gamma subunit antibody
    • 11S regulator complex subunit gamma antibody
    • Activator of multicatalytic protease subunit 3 antibody
    • Ki antibody
    • Ki antigen antibody
    • Ki nuclear autoantigen antibody
    • Ki, PA28 gamma antibody
    • PA28 gamma antibody
    • PA28g antibody
    • PA28gamma antibody
    • Proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) antibody
    • Proteasome (prosome, macropain) activator subunit 3 antibody
    • Proteasome activator 28 gamma antibody
    • Proteasome activator 28 subunit gamma antibody
    • Proteasome activator complex subunit 3 antibody
    • Proteasome activator subunit 3 antibody
    • PSME3 antibody
    • PSME3_HUMAN antibody
    • REG GAMMA antibody
    • REG-gamma antibody
    see all

Images

  • All lanes : Anti-PSME3 antibody (ab180829) at 1/500 dilution

    Lane 1 : MCF7 cell extract
    Lane 2 : PC-12 cell extract

    Predicted band size: 29 kDa

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab180829. Blue DAPI for nuclear staining.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon cancer tissue labeling PSME3 with ab180829 at 1/50 dilution.

References

ab180829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up