Overview

  • Product name

  • Description

    Rabbit polyclonal to PSMF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, Bat
  • Immunogen

    Synthetic peptide corresponding to Human PSMF1 aa 221-271.
    Sequence:

    LIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMY L


    Database link: NP_848693.2

  • Positive control

    • 293T, HeLa, Jurkat whole cell lysate (ab7899)
  • General notes

     This product was previously labelled as Proteasome Inhibitor subunit 1 PI3 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab140497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 30 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-PSMF1 antibody (ab140497) at 0.4 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 30 kDa


    Exposure time: 3 minutes
  • ab140497 at 1 µg/ml detecting PSMF1 in 293T whole cell lysate by WB following IP.

    Lane 1: ab140497 at 6µg/mg of lysate
    Lane 2: control IgG.

    In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab140497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (MEF)
Gel Running Conditions
Reduced Denaturing
Loading amount
15 µg
Specification
MEF
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted May 26 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up