Overview

  • Product name

  • Description

    Rabbit polyclonal to Psoriasin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to Mouse Psoriasin aa 40-80 conjugated to keyhole limpet haemocyanin.
    Sequence:

    LDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLY


    Database link: Q6S5I3

  • Positive control

    • Rat skin and human lung carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab218207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Tissue specificity

    Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Secreted. Secreted by a non-classical secretory pathway.
  • Information by UniProt
  • Database links

  • Alternative names

    • HID 5 antibody
    • Protein S100 A7 antibody
    • Protein S100-A7 antibody
    • PSOR 1 antibody
    • PSOR1 antibody
    • Psoriasin 1 antibody
    • Psoriasin antibody
    • Psoriasin1 antibody
    • S100 Calcium binding protein A7 antibody
    • S100 calcium-binding protein A7 antibody
    • S100A7 antibody
    • S100A7c antibody
    • S10A7_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat skin tissue labeling Psoriasin with ab218207 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

     

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling Psoriasin with ab218207 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (skin)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10mM sodium citrate, 0.05% Tween 20 (pH 6.0)
Permeabilization
No
Specification
skin
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1.5% · Temperature: RT°C
Fixative
formalin

Abcam user community

Verified customer

Submitted Mar 14 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up