Overview

  • Product name

  • Description

    Rabbit polyclonal to Psoriasin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Bovine Psoriasin aa 1-101. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    MSSSQLEQAITDLINLFHKYSGSDDTIEKEDLLRLMKDNFPNFLGACEKR GRDYLSNIFEKQDKNKDRKIDFSEFLSLLADIATDYHNHSHGAQLCSGGN Q


    Database link: Q28050

  • Positive control

    • WB: Bovine pancreas and thymus lysates; Recombinant bovine Psoriasin protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Tissue specificity

    Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Secreted. Secreted by a non-classical secretory pathway.
  • Information by UniProt
  • Database links

  • Alternative names

    • HID 5 antibody
    • Protein S100 A7 antibody
    • Protein S100-A7 antibody
    • PSOR 1 antibody
    • PSOR1 antibody
    • Psoriasin 1 antibody
    • Psoriasin antibody
    • Psoriasin1 antibody
    • S100 Calcium binding protein A7 antibody
    • S100 calcium-binding protein A7 antibody
    • S100A7 antibody
    • S100A7c antibody
    • S10A7_HUMAN antibody
    see all

Images

  • Anti-Psoriasin antibody (ab231799) at 2 µg/ml + Bovine thymus tissue lysate
  • Anti-Psoriasin antibody (ab231799) at 2 µg/ml + Bovine pancreas tissue lysate
  • Anti-Psoriasin antibody (ab231799) at 1 µg/ml + Recombinant bovine Psoriasin protein

References

ab231799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up