Overview

  • Product name
  • Description
    Rabbit polyclonal to PSPC1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human PSPC1 aa 1-50. The exact sequence is proprietary. NP_001035879.1
    Sequence:

    MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAP


    Database link: Q8WXF1

  • Positive control
    • HeLa, 293T, Jurkat or Mouse NIH3T3 lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab176694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 59 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Regulates, cooperatively with NONO and SFPQ, androgen receptor-mediated gene transcription activity in Sertoli cell line (By similarity). Binds to poly(A), poly(G) and poly(U) RNA homopolymers.
  • Tissue specificity
    Expressed in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.
  • Sequence similarities
    Belongs to the PSPC family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus > nucleolus. Nucleus matrix. Cytoplasm. In punctate subnuclear structures often located adjacent to splicing speckles, called paraspeckles. Colocalizes with NONO and SFPQ in paraspeckles and perinucleolar caps in a RNA-dependent manner. May cycles between paraspeckles and nucleolus. In telophase, when daughter nuclei form, localizes to perinucleolar caps.
  • Information by UniProt
  • Database links
  • Alternative names
    • Paraspeckle component 1 antibody
    • Paraspeckle protein 1 antibody
    • PSP1 antibody
    • Pspc1 antibody
    • PSPC1_HUMAN antibody
    see all

Images

  • Detection of Human PSPC1 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176694 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated PSPC1, ab176694 was used at 0.4 µg/ml.

  • All lanes : Anti-PSPC1 antibody (ab176694) at 1/0.04 dilution

    Lane 1 : HeLa lysate at 50 µg
    Lane 2 : HeLa lysate at 15 µg
    Lane 3 : 293T lysate at 50 µg
    Lane 4 : Jurkat lysate at 50 µg
    Lane 5 : Mouse NIH3T3 lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 59 kDa


    Exposure time: 3 minutes

References

ab176694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up