Overview

  • Product name

    Anti-PSTPIP1 antibody
  • Description

    Rabbit polyclonal to PSTPIP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PSTPIP1 aa 79-323.
    Sequence:

    SLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQK SKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKAR QCKDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILR NALWVHSNQLSMQCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEP PAPVPYQNYYDREVTPLTSSPGIQPSCGMIKRFSGLLHGSPKTTS


    Database link: O43586

  • Positive control

    • Raji cell lysates. Human fetal lymph node tissue.

Properties

  • Form

    Lyophilised:Reconstitute with 200 uL sterile distilled water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 48 kDa.

Target

  • Function

    Involved in regulation of the actin cytoskeleton. May regulate the WAS actin-bundling activity. Bridges the interaction between ABL1 and PTPN18 leading to the ABL1 dephosphorylation. May play a role as a scaffold protein between PTPN12 and WAS and allows PTPN12 to dephosphorylate WAS. Has the potential to physically couple CD2 and CD2AP to WAS. Acts downstream of CD2 and CD2AP to recruit WAS to the T-cell:APC contact site so as to promote the actin polymerization required for synapse induction during T-cell activation (By similarity). Down-regulates CD2-stimulated adhesion through the coupling of PTPN12 to CD2.
  • Tissue specificity

    Highly expressed in the peripheral blood leukocytes, granulocytes and monocytes, namely in T-cells and natural killer cells, and in spleen. Weakly expressed in the thymus, small intestine, lung and placenta.
  • Involvement in disease

    Defects in PSTPIP1 are the cause of PAPA syndrome (PAPAS) [MIM:604416]; also known as pyogenic sterile arthritis, pyoderma gangrenosum and acne or familial recurrent arthritis (FRA). PAPAS is characterized by autosomal dominant inheritance of early onset, primarily affecting skin and joint tissues. Recurring inflammatory episodes lead to accumulation of sterile, pyogenic, neutrophil-rich material within the affected joints, ultimately resulting in significant destruction.
  • Sequence similarities

    Contains 1 FCH domain.
    Contains 1 SH3 domain.
  • Domain

    The coiled domain mediates interaction with PTPN18, PTPN12 and CD2AP. The SH3 domain mediates interaction with WAS and ABL1 (By similarity). The SH3 and coiled-coil domains are necessary for the interaction with MEFV.
  • Post-translational
    modifications

    Dephosphorylated on Tyr-345 by PTPN18, this event negatively regulates the association of PSTPIP1 with SH2 domain-containing proteins as tyrosine kinase. Phosphorylation of Tyr-345 is probably required for subsequent phosphorylation at other tyrosine residues. Phosphorylation is induced by activation of the EGFR and PDGFR in a ABL1 dependent manner. The phosphorylation regulates the interaction with WAS and with MEFV.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Cell projection > lamellipodium. Cytoplasm > perinuclear region. Cleavage furrow. Colocalized with the cortical actin cytoskeleton during interphase, lamellipodia and actin-rich cytokinetic cleavage furrow. Colocalized with WAS to filamentous structures within the cytoplasm. Colocalized with PTPN12 in the cytoplasm and the perinuclear region. Colocalized with CD2AP and WAS in the actin cytoskeleton. Colocalized with CD2, CD2AP and WAS at the site of T-cell:APC contact.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD2 antigen binding protein 1 antibody
    • CD2 binding protein 1 antibody
    • CD2 cytoplasmic tail binding protein antibody
    • CD2-binding protein 1 antibody
    • CD2BP1 antibody
    • CD2BP1L antibody
    • CD2BP1S antibody
    • H PIP antibody
    • H-PIP antibody
    • HPIP antibody
    • PAPAS antibody
    • PEST phosphatase interacting protein 1 antibody
    • PEST phosphatase-interacting protein 1 antibody
    • PPIP1_HUMAN antibody
    • Proline serine threonine phosphatase interacting protein 1 antibody
    • Proline-serine-threonine phosphatase-interacting protein 1 antibody
    • PSTPIP antibody
    • Pstpip1 antibody
    see all

Images

  • Anti-PSTPIP1 antibody (ab197260) at 1/1000 dilution + Raji cell lysates

    Predicted band size: 48 kDa

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded Human fetal lymph node tissue, labeling PSTPIP1 with ab197260 at 1/100 dilution.

References

This product has been referenced in:

  • Xu Y  et al. Pathologic Oxidation of PTPN12 Underlies ABL1 Phosphorylation in Hereditary Leiomyomatosis and Renal Cell Carcinoma. Cancer Res 78:6539-6548 (2018). Read more (PubMed: 30297534) »
  • Meng F  et al. The clinical significance of HPIP and the associated prognosis in cervical cancer. Oncotarget 8:70262-70270 (2017). WB, IHC-P ; Human . Read more (PubMed: 29050277) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up