Anti-PTCD3 antibody (ab243800)
Key features and details
- Rabbit polyclonal to PTCD3
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PTCD3 antibody
See all PTCD3 primary antibodies -
Description
Rabbit polyclonal to PTCD3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment corresponding to Human PTCD3 aa 200-289.
Sequence:DQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFS LMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHA
Database link: Q96EY7 -
Positive control
- WB: RT4 and U-251 MG cell lysates. IHC-P: Human cerebellum tissue. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243800 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 79 kDa. | |
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Mitochondrial RNA-binding protein that has a role in mitochondrial translation. -
Tissue specificity
Abundant in testes, skeletal muscle and heart tissue. -
Sequence similarities
Belongs to the PTCD3 family.
Contains 10 PPR (pentatricopeptide) repeats. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 55037 Human
- Omim: 614918 Human
- SwissProt: Q96EY7 Human
- Unigene: 323489 Human
- Unigene: 623885 Human
-
Alternative names
- DKFZp666K071 antibody
- FLJ20758 antibody
- mitochondrial antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PTCD3 (green) using ab243800 at 4 µg/ml in ICC/IF.
-
All lanes : Anti-PTCD3 antibody (ab243800) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Predicted band size: 79 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PTCD3 antibody (ab243800)
Formalin-fixed, paraffin-embedded human cerebellum tissue stained for PTCD3 using ab243800 at 1/200 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243800 has not yet been referenced specifically in any publications.