Overview

  • Product name

  • Description

    Rabbit polyclonal to PTCH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PTCH2 aa 793-951.
    Sequence:

    QAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLTTR KLVDREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDT TGENLRIPPAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGV HAYPSGSPF


    Database link: Q9Y6C5

  • Positive control

    • IHC-P: Human brain tissue. ICC/IF: HEK-293 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May have a role in epidermal development. May act as a receptor for Sonic hedgehog (SHH).
  • Involvement in disease

    Defects in PTCH2 are a cause of medulloblastoma (MDB) [MIM:155255]. MDB is a malignant, invasive embryonal tumor of the cerebellum with a preferential manifestation in children. Although the majority of medulloblastomas occur sporadically, some manifest within familial cancer syndromes such as Turcot syndrome and basal cell nevus syndrome (Gorlin syndrome).
    Defects in PTCH2 are a cause of sporadic basal cell carcinoma (BCC) [MIM:605462].
  • Sequence similarities

    Belongs to the patched family.
    Contains 1 SSD (sterol-sensing) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • patched (Drosophila) homolog 2 antibody
    • patched homolog 2 (Drosophila) antibody
    • Protein patched homolog 2 antibody
    • PTC2 antibody
    • PTC2_HUMAN antibody
    • Ptch2 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for PTCH2 using ab238338 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HEK-293 (Human epithelial cell line from embryonic kidney) cells stained for PTCH2 (green) using ab238338 at 1/66 dilution in ICC/IF. Secondary antibody is an Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab238338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up